Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 8 1.4 8.4e+03 -0.3 0.0 23 45 36 58 33 65 0.79

2 8 0.059 3.5e+02 4.1 0.0 21 51 62 92 54 94 0.84

3 8 0.026 1.6e+02 5.2 0.0 21 44 118 141 114 145 0.91

4 8 0.0013 7.8 9.4 0.0 20 47 145 172 142 178 0.87

5 8 0.1 6.1e+02 3.4 0.1 22 52 175 205 171 208 0.85

6 8 0.35 2.1e+03 1.6 0.0 22 48 231 257 228 261 0.81

7 8 0.051 3.1e+02 4.3 0.0 21 44 258 281 250 285 0.90

8 8 0.013 78 6.2 0.0 20 52 285 317 282 319 0.89

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	8	1.4	8.4e+03	-0.3	0.0	23	45	36	58	33	65	0.79
2	8	0.059	3.5e+02	4.1	0.0	21	51	62	92	54	94	0.84
3	8	0.026	1.6e+02	5.2	0.0	21	44	118	141	114	145	0.91
4	8	0.0013	7.8	9.4	0.0	20	47	145	172	142	178	0.87
5	8	0.1	6.1e+02	3.4	0.1	22	52	175	205	171	208	0.85
6	8	0.35	2.1e+03	1.6	0.0	22	48	231	257	228	261	0.81
7	8	0.051	3.1e+02	4.3	0.0	21	44	258	281	250	285	0.90
8	8	0.013	78	6.2	0.0	20	52	285	317	282	319	0.89

Coding Sequence: ATGAGAACGCATATTGGTGAAAAGCTATTTGGATGTCAAGTATGCACAAAACATTTTCTCACAAATGCTCACTTAAAAACACATATGGTGGTGCATACTGGTGTAAAACCATTTGGATGCGAAATATGCACAAAACAGTTTACACAACTGCCTCATTTAAAAGTTCATATGAGAACGCATaatggtgaaaaaccatttggatGTCAAGTATGCACAAAACAGTTTTCCACAAATGATCACTTAAAAAGACATATGGTGGTGCATACTGGTGTAAAACCATTTGAATGCGAAATATGCACAAAACAGTTTGTAACGCACAATGAGTTAAAAATACATATGGTGGTGCAttctggtgaaaaaccatttggatGTAAAATATGCACAAAACAGTTTAGACGAACTGCTGACTTAAAATCTCATATGATTACCCACACTAGTGAAAAACCATTTGGATGTAAAATATGCACAAAACAGTTTACACAACTTTCTAATTTAAAAATTCATATGAGAATGCACATTGGTGAAAAACCTTTTGGATGTCAAGTATGCACAAAACAGTTTTTAAGAAATGATCACCTAAAAAGACATATGGTAGTGCATACTGGTGTAAAACCATTTGGATGTGAAATATGCACAAAACAGTTTGTAACACACAATGAGTTAAAAATACATATGGtggtgcatactggtgaaaaaacATTTGGATGTGAAATATGCACAAAACAGTTTGCACGAAGTTCTGACTTAAAAGTTCATATGagaattcacactggtgaaaaaccatttggatGTAAAATATGCAAAAAACAGTATAGACGAACTTGGGACTTAAAATCTCATATGATAACCCACACTAGTGAAAAACCGTTTGGATGTAAATTTTGCACCAAAGAGTTTTCCCGAAGTTCtgatttaaaaatacatttgagaattcacactggagaaaaaccatttGTGAAATTTGCATAA
Protein Sequence: MRTHIGEKLFGCQVCTKHFLTNAHLKTHMVVHTGVKPFGCEICTKQFTQLPHLKVHMRTHNGEKPFGCQVCTKQFSTNDHLKRHMVVHTGVKPFECEICTKQFVTHNELKIHMVVHSGEKPFGCKICTKQFRRTADLKSHMITHTSEKPFGCKICTKQFTQLSNLKIHMRMHIGEKPFGCQVCTKQFLRNDHLKRHMVVHTGVKPFGCEICTKQFVTHNELKIHMVVHTGEKTFGCEICTKQFARSSDLKVHMRIHTGEKPFGCKICKKQYRRTWDLKSHMITHTSEKPFGCKFCTKEFSRSSDLKIHLRIHTGEKPFVKFA*

Sequence clustering based on sequence similarity using MMseqs2