g111621.t1
Basic Information
- Insect
- Diabrotica virgifera
- Gene Symbol
- -
- Assembly
- GCA_003013835.2
- Location
- PXJM02481206.1:70-627[+]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 6 1.1e-05 0.066 16.0 0.1 21 49 6 33 4 38 0.89 2 6 3.8 2.3e+04 -1.7 0.0 23 43 36 56 34 61 0.68 3 6 0.00045 2.7 10.9 0.1 21 46 62 87 56 91 0.91 4 6 0.22 1.3e+03 2.3 0.0 24 46 93 115 88 121 0.83 5 6 0.39 2.3e+03 1.5 0.1 21 47 118 144 110 149 0.77 6 6 0.00085 5.1 10.0 0.1 21 45 146 170 138 177 0.89
Sequence Information
- Coding Sequence
- ATGATAATTCACACGGgtgaaaaacctcacaagtgtgaaatttgttataAGACGTTTAACCAAAAATGTAACTTAAATATGCATATGACTTtgcactttggagaaaaatctcACGAATGTGAGGTTTGTTTTAAACGCTTTAGTAAAGCAGGTGATTTGATAACACATGTTAGAGTTCACACAGGTGAAAAACCTTATGTATGTAAAATTTGCTGTAAGTTGTTTTCTCAGAAATCTAATTTAAGTGCGCACATGAAATTGCACATTGGAGAGACATATCACACGTGTGACATCTGTTTAAAACCGTTTAATGAAGTCCATGATTTGGAAAAACATGTTAAAATACACATTGGAGAAAATCCTCACAATTGTGAGACATGTTTTAAGCCGTTTACTTCACAAAGTAAACTAAAGATTCATATGAGAATTCACACAGgtgaaaaacctcacaagtgtgaaatttgttctaagctgTTTAACCAAAAATCTAATTTAAATACACATATGAAATCGCACAGTATACAAAAATCACACACTGGAGAAGAATTTCACAATTGA
- Protein Sequence
- MIIHTGEKPHKCEICYKTFNQKCNLNMHMTLHFGEKSHECEVCFKRFSKAGDLITHVRVHTGEKPYVCKICCKLFSQKSNLSAHMKLHIGETYHTCDICLKPFNEVHDLEKHVKIHIGENPHNCETCFKPFTSQSKLKIHMRIHTGEKPHKCEICSKLFNQKSNLNTHMKSHSIQKSHTGEEFHN*
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00437443;
- 90% Identity
- iTF_00437443;
- 80% Identity
- iTF_00437443;