Basic Information

Transcription Factor Domain

TF Family: BTB
Domain: zf-C2H2|ZBTB
PFAM: PF00651
TF Group: Zinc-Coordinating Group
Description: The BTB (for BR-C, ttk and bab) [6] or POZ (for Pox virus and Zinc finger) [1] domain is present near the N-terminus of a fraction of zinc finger (Pfam:PF00096) proteins and in proteins that contain the Pfam:PF01344 motif such as Kelch and a family of pox virus proteins. The BTB/POZ domain mediates homomeric dimerisation and in some instances heteromeric dimerisation [1]. The structure of the dimerised PLZF BTB/POZ domain has been solved and consists of a tightly intertwined homodimer. The central scaffolding of the protein is made up of a cluster of alpha-helices flanked by short beta-sheets at both the top and bottom of the molecule [2]. POZ domains from several zinc finger proteins have been shown to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes including N-CoR and SMRT [5, 3, 4]. The POZ or BTB domain is also known as BR-C/Ttk or ZiN.
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 2 1.5e-29 2.8e-26 94.6 0.1 2 109 60 166 59 167 0.93

2 2 6.2 1.2e+04 -0.8 0.1 85 85 207 207 176 237 0.51

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	2	1.5e-29	2.8e-26	94.6	0.1	2	109	60	166	59	167	0.93
2	2	6.2	1.2e+04	-0.8	0.1	85	85	207	207	176	237	0.51

Coding Sequence: ATGTCTCTTGCAGAAAGCCCCTCCAAAGATTCGGTTACTATGAGTTTAGAAGGAAGTATTAATAATTTATCGAGTGAGTTTAGTATATTGTCCATGTCTTTGTGTTCAACGATGTCTTCAACCCAGCTAGAGCATTTTAGATGCGAAGGTCATGCTGAGCATAGTTTAGCATGTATGAAAAACTATCTACAGGGTGGAAAGCTTTGTGATGTTACCCTCATTGCGGGATCCAATGGGAAACGAGTGCAAGCACACAGGTTGGTCCTTTCTGCAGCTAGTGAATATTTTTCGGCAATGTTTACAGGAAGTTTAAGTAACAATGAGTCTGAAATAACGTTGGTAAATGTGAATGGTGATATATTACAAGCAGTTGTAAATTATTGCTACACAGGGTGTATAGAAATAAGAGAAGATAATGTGGAAACACTGTTATCTACAGCATGTCTGATGTTGTTACATGAAGTGGTGGAAGCCTGCtcaagATTTCTAGCTCATCAACTACATCCTAGCAATTGTTTGGGGATAGCAAATTTTGCAGAGCATCAAGCAATTTCAAGCTTATTGCAAGAGGCTAATGCTTATACCAGTCAACATTTCATGCAAgtGATACGAAACCAGGAGTTCCTTCAGCTCGATGTCGACCAAATGGCAACACTGTTGAATAATGATGATTTAAATGTGATCTGTGAGGAACACATCTTCCAGGCACTGATGAGCTGGATTCAGTACGATACAGATTCTAGGCGTCAGTACATCGGTCACTTGCTGGGTTTCGTGAAACTACCCTTATTAAATCCAGCATTTTTGACAGACCAAGTTGAACCAGTTTGTGAAGCTGATGTAGTTTTTGTTCATCATAAATCATGTTGCTCCCATATCGTCTACACACcgccagtggcgtaa
Protein Sequence: MSLAESPSKDSVTMSLEGSINNLSSEFSILSMSLCSTMSSTQLEHFRCEGHAEHSLACMKNYLQGGKLCDVTLIAGSNGKRVQAHRLVLSAASEYFSAMFTGSLSNNESEITLVNVNGDILQAVVNYCYTGCIEIREDNVETLLSTACLMLLHEVVEACSRFLAHQLHPSNCLGIANFAEHQAISSLLQEANAYTSQHFMQVIRNQEFLQLDVDQMATLLNNDDLNVICEEHIFQALMSWIQYDTDSRRQYIGHLLGFVKLPLLNPAFLTDQVEPVCEADVVFVHHKSCCSHIVYTPPVA*

Sequence clustering based on sequence similarity using MMseqs2