Basic Information

Transcription Factor Domain

TF Family: BTB
Domain: zf-C2H2|ZBTB
PFAM: PF00651
TF Group: Zinc-Coordinating Group
Description: The BTB (for BR-C, ttk and bab) [6] or POZ (for Pox virus and Zinc finger) [1] domain is present near the N-terminus of a fraction of zinc finger (Pfam:PF00096) proteins and in proteins that contain the Pfam:PF01344 motif such as Kelch and a family of pox virus proteins. The BTB/POZ domain mediates homomeric dimerisation and in some instances heteromeric dimerisation [1]. The structure of the dimerised PLZF BTB/POZ domain has been solved and consists of a tightly intertwined homodimer. The central scaffolding of the protein is made up of a cluster of alpha-helices flanked by short beta-sheets at both the top and bottom of the molecule [2]. POZ domains from several zinc finger proteins have been shown to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes including N-CoR and SMRT [5, 3, 4]. The POZ or BTB domain is also known as BR-C/Ttk or ZiN.
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 3 3.3 1.2e+03 0.4 0.1 48 84 109 144 101 165 0.67

2 3 5.8e-26 2.1e-23 83.2 0.1 9 108 198 297 190 299 0.90

3 3 0.33 1.2e+02 3.5 0.1 78 109 299 330 294 331 0.88

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	3	3.3	1.2e+03	0.4	0.1	48	84	109	144	101	165	0.67
2	3	5.8e-26	2.1e-23	83.2	0.1	9	108	198	297	190	299	0.90
3	3	0.33	1.2e+02	3.5	0.1	78	109	299	330	294	331	0.88

Coding Sequence: ATGAAGAGATATTTCAGTCCCATGAACGACAAGTCAAATATGGCGTCCCGCAAGGACAGTCCAGAGATTGTATTTGGCCATAAATGCTGCCAGACAAGCGAAGCTAAATGGTTAGCTATTGAAGAACTGTACGAAAAGATGCAAAGACCTCATTACTACGACGTCGGGGGCACATATAGTCAAGATAAACCAGATTACTGGTTCACATGTAAAACTGAGCAAGTGCTGGATATGTTCCTTCTACACTTGTTCATTTACAAACACAACGAAGGCTCCTACAACATAGCAGTTAGCGCAGGAAGTGAGCTGACGAACGACAAGAAAAACAACACAGTTAATTTGCCGTTATTGCTTAaaaaattcgaattcaataataGTAAAAGTATGTTGGATATGGCACATTTTGATGAAGTCAGTGTCGGCCCAATAGAATATGTGACTACATATAATTTTACCGATCTTGATGTTGACGCTATGAAAGACAAGATTCTCCTCATAGCGGTTTCATTTGAATCTCACAAAGATTTAAATGTTGGTATGTTGgatgaaatcaaattaaatcacGACTTTGGGGCCTTGTTAAGGGATCCGGTCGGCTCGGACTTTACAATTGAGACTGGAGACGGAGAAAAGTTTAAAGTGCACAGAATGATCCTTTCAGCTCACAGCACAGTGTTCAAAGCCATGTTTAAAGAGGAAACGGCTGAGAGCCAGAATAGTTACGTGAAACTTGTAGATGTGAAGGCAGaggatttcaaatatttattggagTATATTTACACAGGAACTATAAAGGATATGGAGGGTGTGGACTTCGCCAATCTACTCATACTTGCTGACATGTATAATTTGAAAGGTCTTTGGACTCTGTCCCAAATAGCACTCGCGAAGCAACTGACAATGTCAAATGCGGCCTACACGCTAGTCGTGGCAGATATGTACGATGCTGATTATTTGaagaattttacattaaaatatctcAAGAAGAACGCTAGTGCGCTAGATAGCAATGCTtttagtgaaataaataatgtcgACCTTATGAAGCAACTCGTTACATACATTACTACTCAGTAG
Protein Sequence: MKRYFSPMNDKSNMASRKDSPEIVFGHKCCQTSEAKWLAIEELYEKMQRPHYYDVGGTYSQDKPDYWFTCKTEQVLDMFLLHLFIYKHNEGSYNIAVSAGSELTNDKKNNTVNLPLLLKKFEFNNSKSMLDMAHFDEVSVGPIEYVTTYNFTDLDVDAMKDKILLIAVSFESHKDLNVGMLDEIKLNHDFGALLRDPVGSDFTIETGDGEKFKVHRMILSAHSTVFKAMFKEETAESQNSYVKLVDVKAEDFKYLLEYIYTGTIKDMEGVDFANLLILADMYNLKGLWTLSQIALAKQLTMSNAAYTLVVADMYDADYLKNFTLKYLKKNASALDSNAFSEINNVDLMKQLVTYITTQ

Sequence clustering based on sequence similarity using MMseqs2