Ddia012622.1
Basic Information
- Insect
- Dasypogon diadema
- Gene Symbol
- Aef1
- Assembly
- GCA_006980735.1
- Location
- jcf7180002948615:2704-12246[-]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 4 0.018 68 3.5 0.2 22 46 34 58 13 61 0.89 2 4 9e-06 0.034 14.0 0.1 21 51 61 91 59 92 0.88 3 4 0.0027 10 6.1 0.0 21 51 89 119 87 120 0.87 4 4 8.3e-05 0.32 10.9 0.1 21 47 117 143 114 148 0.89
Sequence Information
- Coding Sequence
- ATGACCAATTACGAATTCGTAACAAAATACTTCAATAATATTGAGGGACCTATGTCTCGAGCGTTGAGCCGAACAATGACTGTAGCCAACGGCCCTGTTGATAAACCATTTCAATGTAATGTTTGCGAAAGGCGATTTCGACAATTAAGTACCCTCACAAATCATGTAAAAATTCATACTGGAGAAAAACCCTACAAATGTACAATATGCGAGAAACATTTCCGGCAATCCAGTACACTGACGAATCACTTGAAAATACACACAGGCGAAAAGCCATTCAATTGCACCTACTGCGGCAAACAGTTTCGTCAGCTAAGCACACTGACGAATCATTTGAAAATTCACACGGGTGAAAAACCGTTCGAATGTGCAGTTTGCAAAAAACAATTTCGCCAATCGAGTACGCTCAATAATCACATAAAGATTCATGTCATGGATAAACTCTATTTACCTTTTGAAATAAAATCGGAAGAAGAGGAAGAAGGCTGA
- Protein Sequence
- MTNYEFVTKYFNNIEGPMSRALSRTMTVANGPVDKPFQCNVCERRFRQLSTLTNHVKIHTGEKPYKCTICEKHFRQSSTLTNHLKIHTGEKPFNCTYCGKQFRQLSTLTNHLKIHTGEKPFECAVCKKQFRQSSTLNNHIKIHVMDKLYLPFEIKSEEEEEG
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00203877;
- 90% Identity
- iTF_01540912;
- 80% Identity
- iTF_00424890;