Basic Information

Transcription Factor Domain

TF Family: zf-LITAF-like
Domain: zf-LITAF-like domain
PFAM: PF10601
TF Group: Zinc-Coordinating Group
Description: Members of this family display a conserved zinc ribbon structure [3] with the motif C-XX-C- separated from the more C-terminal HX-C(P)X-C-X4-G-R motif by a variable region of usually 25-30 (hydrophobic) residues. Although it belongs to one of the zinc finger's fold groups (zinc ribbon), this particular domain was first identified in LPS-induced tumour necrosis alpha factor (LITAF) which is produced in mammalian cells after being challenged with lipopolysaccharide (LPS)[2]. The hydrophobic region probably inserts into the membrane rather than traversing it. Such an insertion brings together the N- and C-terminal C-XX-C motifs to form a compact Zn2+-binding structure [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 3 0.3 1.4e+03 -0.1 0.1 57 67 4 14 2 17 0.64

2 3 1.7e-18 7.8e-15 55.1 3.3 2 70 90 158 89 158 0.97

3 3 0.31 1.4e+03 -0.2 0.2 3 11 161 169 159 181 0.77

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	3	0.3	1.4e+03	-0.1	0.1	57	67	4	14	2	17	0.64
2	3	1.7e-18	7.8e-15	55.1	3.3	2	70	90	158	89	158	0.97
3	3	0.31	1.4e+03	-0.2	0.2	3	11	161	169	159	181	0.77

Coding Sequence: ATGGACCAGCTGACATGTCAGATATGTGGCGACAAATTAGCTTTCAATCCGGAATGCCCTTGCTCGTTAGGTGAGCACTTGTTGAGCCGTCATCCTGAATTGGAAATGGCGCATTTTTCACGCGAAGATTTGTTTTGCCGCTGCAGTTCCGAGAGAATTCCGCAAGACCACGCCCCAAAAAAGAAACCTTCTCCGTCGGTGAGATTTAGAACTAAGTCTCGTAGCGGTCAAGCTCTTTTCAAGACGACTGTCGAGACTTGGAGACCCGGGCCTCGGATGGTCACTTGTCCTCAATGCAATTACTTAGAGCGGCCTTGTATCAGAAAGCAAAGAAACAGAGTTGCGTACTCGACCATAGGTGCGTTGTGTCTCCTATTGTGCTGGCCGATTTGCTTCCTCCCTTTTTTTCTTCCGCATGGTAGCGATATCGAATTGTTTTGCAAGAAATGCGGAGCCTTTCTGGGCAGATACGATCGACAGACAGGAACGATGACGTGCCCCCCTTGTCCCCCTGTAAACGGCAAAAATGTCAACGACAAACCTCCGATGTGCTga
Protein Sequence: MDQLTCQICGDKLAFNPECPCSLGEHLLSRHPELEMAHFSREDLFCRCSSERIPQDHAPKKKPSPSVRFRTKSRSGQALFKTTVETWRPGPRMVTCPQCNYLERPCIRKQRNRVAYSTIGALCLLLCWPICFLPFFLPHGSDIELFCKKCGAFLGRYDRQTGTMTCPPCPPVNGKNVNDKPPMC

Sequence clustering based on sequence similarity using MMseqs2