Cper014305.1
Basic Information
- Insect
- Cydalima perspectalis
- Gene Symbol
- dsx
- Assembly
- GCA_951394215.1
- Location
- OX596216.1:5212592-5213107[-]
Transcription Factor Domain
- TF Family
- DM
- Domain
- DM domain
- PFAM
- PF00751
- TF Group
- Zinc-Coordinating Group
- Description
- The DM domain is named after dsx and mab-3 [2]. dsx contains a single amino-terminal DM domain, whereas mab-3 contains two amino-terminal domains. The DM domain has a pattern of conserved zinc chelating residues C2H2C4 [1]. The dsx DM domain has been shown to dimerise and bind palindromic DNA [3].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 3.2e-24 1.7e-20 73.2 11.8 2 47 32 77 31 77 0.97
Sequence Information
- Coding Sequence
- ATGGTGTCCATGGGCGCGTGGAGGCGCCGCGCGCCCCAAGATTGCGAGGAGCGCTCCGAGCCCGGCGCCTCTAGCTCGGGCGTGCCGCGCGCCCCTCCGAACTGCGCGCGCTGCCGCAACCACCGGCTGAAGGTTGAGTTGAAGGGACACAAGCGCTACTGCAAGTACCGGTACTGCACCTGCGAGAAGTGCCGGCTGACGGCCGATAGGCAGCGGGTGATGGCTCTTCAGACAGCGCTGCGGCGTGCCCAGCAACAGGACgaggcgcgtgcgcgggcgctgGAGGAGACAGGCCAGCAGCCTACGGGTATCGAGTTGGACCGGCCGGAGCCGCCGGTGGTGAAGGCGCCGCGCAGCCCGGTGGTgccaccgccgccgccgcggtCGCTGGGCTCCGCCAGCTGCGACTCCGTGCCCGGCTCCCCGGGGGTGTCTCCGTACGCGCCACCGCCGCCCCCGTCCGCTCTGCCGCCACCCAACCTGCCGCCGCTGCTGCCGCCCCAGCAACCCGGTTAG
- Protein Sequence
- MVSMGAWRRRAPQDCEERSEPGASSSGVPRAPPNCARCRNHRLKVELKGHKRYCKYRYCTCEKCRLTADRQRVMALQTALRRAQQQDEARARALEETGQQPTGIELDRPEPPVVKAPRSPVVPPPPPRSLGSASCDSVPGSPGVSPYAPPPPPSALPPPNLPPLLPPQQPG
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01317340;
- 90% Identity
- iTF_01071676;
- 80% Identity
- -