Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 8 0.013 9.8 5.9 0.1 21 44 13 36 1 43 0.75

2 8 0.26 2e+02 1.7 0.4 22 43 42 63 36 68 0.83

3 8 0.32 2.5e+02 1.4 0.0 22 43 70 91 64 95 0.81

4 8 3.9e-05 0.03 13.9 0.8 20 46 96 122 85 128 0.80

5 8 0.0047 3.7 7.3 0.0 21 47 125 151 120 157 0.83

6 8 1.3 9.9e+02 -0.5 0.0 7 19 148 160 144 169 0.79

7 8 0.015 11 5.7 0.1 21 45 182 206 175 214 0.87

8 8 0.49 3.9e+02 0.8 0.2 21 43 210 232 205 237 0.81

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	8	0.013	9.8	5.9	0.1	21	44	13	36	1	43	0.75
2	8	0.26	2e+02	1.7	0.4	22	43	42	63	36	68	0.83
3	8	0.32	2.5e+02	1.4	0.0	22	43	70	91	64	95	0.81
4	8	3.9e-05	0.03	13.9	0.8	20	46	96	122	85	128	0.80
5	8	0.0047	3.7	7.3	0.0	21	47	125	151	120	157	0.83
6	8	1.3	9.9e+02	-0.5	0.0	7	19	148	160	144	169	0.79
7	8	0.015	11	5.7	0.1	21	45	182	206	175	214	0.87
8	8	0.49	3.9e+02	0.8	0.2	21	43	210	232	205	237	0.81

Coding Sequence: CAGGGTacactgaagacacatcagcacgTGCATAGTGGGGAAAAGCCATTTAGGTGTGATATATGTGATAAGTCATTTAATAGGCaaagtaatctgaagacacatcagcgcatacatagtgggaagCAGTCATTtagatgtgatgtatgtaataagtcatttaatcTGCAATGTAATCTCAGGAAGCATGAGCGTATACATAGTGGGGACTGGCCATTTACCTGTGGTGTGTGTAGTAAGACATTCGGAGTGAAGGGTacactgaagagacatcagtgcatgcatagtggggagaagccatttagGTGTGacatatgtaataagtcatttaatcAGCAATGTAATCTGAGGAGGCATGAGcgtatacatagtggggagaagccatttacCTGTGATGTGTGTAGTAAGACATTCAGAGAGAAGGGTACACTGAAGTCACATCAGCACgtgcatagtggggagaagccatttagtagatgtgatgtatgtaacaaATCATTCAGTCGGCAGACTTATCTGCagacacatcaacgcatacatagagGGGAGTGGCCATTtagatgtgatgtatgtaataagtcattcagagaGCAGAGTAcgctgaagagacatcagcgcatacatagtggggagcggccattcaGATGTGATGTATGTAGCAAATCATTCAGTGATCAAGGTCATCTGGAgaggcatcagcgcatacatgttgatgtatgtagtaaatcatag
Protein Sequence: QGTLKTHQHVHSGEKPFRCDICDKSFNRQSNLKTHQRIHSGKQSFRCDVCNKSFNLQCNLRKHERIHSGDWPFTCGVCSKTFGVKGTLKRHQCMHSGEKPFRCDICNKSFNQQCNLRRHERIHSGEKPFTCDVCSKTFREKGTLKSHQHVHSGEKPFSRCDVCNKSFSRQTYLQTHQRIHRGEWPFRCDVCNKSFREQSTLKRHQRIHSGERPFRCDVCSKSFSDQGHLERHQRIHVDVCSKS

Sequence clustering based on sequence similarity using MMseqs2