Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 10 0.085 66 3.2 0.3 21 43 21 43 11 48 0.75

2 10 0.00019 0.15 11.7 0.3 20 45 48 73 39 77 0.84

3 10 0.018 14 5.4 0.6 20 43 76 99 72 104 0.84

4 10 0.13 1.1e+02 2.6 0.1 21 45 105 129 100 136 0.87

5 10 2.3 1.8e+03 -1.3 0.1 22 44 134 156 123 164 0.79

6 10 0.95 7.4e+02 -0.1 0.4 21 32 161 172 135 187 0.73

7 10 0.00085 0.67 9.6 0.1 21 44 189 212 181 216 0.90

8 10 0.25 1.9e+02 1.7 0.2 21 33 217 229 214 243 0.76

9 10 0.00063 0.49 10.1 0.1 21 44 245 268 237 272 0.89

10 10 0.0049 3.8 7.2 0.2 20 43 272 295 268 300 0.87

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	10	0.085	66	3.2	0.3	21	43	21	43	11	48	0.75
2	10	0.00019	0.15	11.7	0.3	20	45	48	73	39	77	0.84
3	10	0.018	14	5.4	0.6	20	43	76	99	72	104	0.84
4	10	0.13	1.1e+02	2.6	0.1	21	45	105	129	100	136	0.87
5	10	2.3	1.8e+03	-1.3	0.1	22	44	134	156	123	164	0.79
6	10	0.95	7.4e+02	-0.1	0.4	21	32	161	172	135	187	0.73
7	10	0.00085	0.67	9.6	0.1	21	44	189	212	181	216	0.90
8	10	0.25	1.9e+02	1.7	0.2	21	33	217	229	214	243	0.76
9	10	0.00063	0.49	10.1	0.1	21	44	245	268	237	272	0.89
10	10	0.0049	3.8	7.2	0.2	20	43	272	295	268	300	0.87

Coding Sequence: aagtgtaataagtcattcagtgagaAGAGTAATCtcaagacacatcagcgcatacacagtggggagcagccattttgctgtgatgtgtgtaataagacATTCGGTGTGCACAGTAGTCTGAAGAAACATAAGCGCAttcatagtggggagcggccatttatATGTGACATTTGTACTAAGTCATTCCGTCAGCAAAgtagtctgaagagacatcagtcCATGCATAGTGGTGAACAGCCATTTAGATGTGATgtttgtaataagtcattcaatcGGCAATgtagtctgaagagacatcagcccatacatagtggtgagcggccatttagatgtgatgtgtgtaataagtcattcaatcAGTTGGATCATCTGAAGAAGCATCAGCACATACACAGTCGGGATCACCCATTTTGTTGTGACAAATGTAATAAGTCGTTCAGTGAggagagtaatctgaagacacatcagcgcatacatagtggggaacggccattttgctgtgatgtgtgtaataagacATTCGGTTTGCAGAGTATTCTGAAGAAACATAAGCTCATTCATAGTGGGGAACGGCCATTTATATGTGACATGTGTAATAAGTTATTCCGTCAGCAAAgtagtctgaagagacatcagcccatacatagtggggagcagccattttgctgtgatgtctGTAATAAGACATTCGGTTTGCAGAGTATTCTGAAGAAACATAAGCTCATTCATAGTGGGGAACGGCCATTTATATGTGACATGTGTAATAAGTTATTCCGTCAGCAAAgtagtctgaagagacatcagtcTATGCATAGTGGTGAGCGACCATTTagatgtgatgtgtgtaataagtcattcagtcagcaaaGTAATGTGAAGAGacatcagctcatacatagtggtgaa
Protein Sequence: KCNKSFSEKSNLKTHQRIHSGEQPFCCDVCNKTFGVHSSLKKHKRIHSGERPFICDICTKSFRQQSSLKRHQSMHSGEQPFRCDVCNKSFNRQCSLKRHQPIHSGERPFRCDVCNKSFNQLDHLKKHQHIHSRDHPFCCDKCNKSFSEESNLKTHQRIHSGERPFCCDVCNKTFGLQSILKKHKLIHSGERPFICDMCNKLFRQQSSLKRHQPIHSGEQPFCCDVCNKTFGLQSILKKHKLIHSGERPFICDMCNKLFRQQSSLKRHQSMHSGERPFRCDVCNKSFSQQSNVKRHQLIHSGE

Sequence clustering based on sequence similarity using MMseqs2