Cpri018845.1
Basic Information
- Insect
- Cryptocephalus primarius
- Gene Symbol
- -
- Assembly
- GCA_963576515.1
- Location
- OY754956.1:5546286-5547380[-]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 6 3.8 2.3e+03 -1.0 0.1 14 26 87 99 81 105 0.76 2 6 1.1 6.6e+02 0.7 0.0 22 45 119 142 105 150 0.80 3 6 0.049 29 5.0 0.1 14 44 166 197 163 202 0.83 4 6 0.0015 0.92 9.9 0.0 21 46 202 227 198 229 0.91 5 6 0.002 1.2 9.5 0.0 22 52 231 261 228 262 0.89 6 6 0.23 1.4e+02 2.9 0.0 21 44 258 281 256 285 0.88
Sequence Information
- Coding Sequence
- ATGAGCGTTACCAAAGTGGGTGCCTGTGATTGGTGCTTGCAAGAGGTGCCATTGCAGACGATCGATGAGaggttatggcgcttctggaaagTAATTAGCGTGGAGGATCCGACCGTGGGGTCTCACCGGAACATCTGCGGGAACTGCAGCTCACGCTTCCGGGAGTTCTCGACGTACGTCGACAGGTGCAGGACCCATGCTTCCATAATAGACGAGCTACTGTCCGTCGGAGACGACGTCGAGTATCCCCCGTTAATAAAGCAAGAAGAACGATCGTGCTCCGATCACCCCGCCGCGGGCTGTTCGAGCGTCCCCGAGGGGTCCGACGGAGAAGCTCCGTCCCCCGTGGGATCCTCCTCGGACCTCACGTGTTCTCATTGCGGTAAAACTTTCGATCGCTCTAGTAAATTGAAGGCGCACCTGTACAGCCATAAGGACGAGAAGCCTTTCAAGTGTTCGCATTGCGATAAGGCTTACGTGTGGTACAGCGAGTTGAAGGTACACTCGCGCAGTCACGCTGGTGAATACCTCTGCAAGTGTCCGTTCTGCGATAAGGCTTTCGCTCGGTCCAACAACTTCCACAGCCACGTACGCACccatacgggcgagaagcctttcGAGTGCTCCGTCTGCGGTAAGACTTTCATCCAGTCCGGTAATTTGAAGACGCACATGCGCCTCCACACGGGGGAGGAGCCTTTCAGGTGTTCGCTGTGTGGCAAGGGTTTTACCCAGTCTAGTGTTTTGAagaggcacatgcgccttcatacgggGGAGAAGCCTTTTGGATGTTCGatatgtaataagaattttacttgGTCCAGTAGTTTGAAGAGCCACATGCGCGGTCACAGGAGGGACGACGTTTAA
- Protein Sequence
- MSVTKVGACDWCLQEVPLQTIDERLWRFWKVISVEDPTVGSHRNICGNCSSRFREFSTYVDRCRTHASIIDELLSVGDDVEYPPLIKQEERSCSDHPAAGCSSVPEGSDGEAPSPVGSSSDLTCSHCGKTFDRSSKLKAHLYSHKDEKPFKCSHCDKAYVWYSELKVHSRSHAGEYLCKCPFCDKAFARSNNFHSHVRTHTGEKPFECSVCGKTFIQSGNLKTHMRLHTGEEPFRCSLCGKGFTQSSVLKRHMRLHTGEKPFGCSICNKNFTWSSSLKSHMRGHRRDDV
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00392901;
- 90% Identity
- iTF_00392901;
- 80% Identity
- iTF_00392901;