Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 0.0085 5.1 7.5 0.1 21 45 60 84 52 92 0.85

2 6 0.0031 1.9 8.9 0.0 23 48 90 115 84 119 0.85

3 6 0.00089 0.54 10.6 0.0 21 48 116 143 112 147 0.87

4 6 0.0036 2.1 8.7 0.5 22 51 145 174 141 175 0.86

5 6 0.56 3.4e+02 1.7 0.1 22 45 173 196 169 202 0.81

6 6 0.00025 0.15 12.4 0.0 21 52 228 259 225 261 0.87

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	0.0085	5.1	7.5	0.1	21	45	60	84	52	92	0.85
2	6	0.0031	1.9	8.9	0.0	23	48	90	115	84	119	0.85
3	6	0.00089	0.54	10.6	0.0	21	48	116	143	112	147	0.87
4	6	0.0036	2.1	8.7	0.5	22	51	145	174	141	175	0.86
5	6	0.56	3.4e+02	1.7	0.1	22	45	173	196	169	202	0.81
6	6	0.00025	0.15	12.4	0.0	21	52	228	259	225	261	0.87

Coding Sequence: ATGAGAGTAACAAAGATCCTCGCTTGTATGAAGACGAAACAAGAACATTGTATCGATATCGAGTATCACCCCGTGATTaaagaagaaatagaaaatcATGCTTCTCACGTATGTCCGTTCTGCGATAAACGTTTCTTCACCGCTTACCGCCTGAAGGTCCACTCGCTCGCTCATACAGGAGAAAGGCCTTATAAATGTTCACGTTGCAATAAGACTTTCGCTCAGTCTGGTACTTTGAACAGACACTTGCTCAGTCACGCAAACGTTAAACCCTTCAAATGTCCACATTGCGATAAAGCGTTTTCTCAGTCTTTCGGCTTGAAGAGGCACGTCCGTATCCACGCGGGCGAGAAGCCGTATACGTGTCCACAGTGCAGCAAGACTTTCATCGAGTCGGGAGCTTTAAAGAAACACTTGTACATTCATACCGATGACAAGCCTTACGGATGTCCACATTGCGACAAAGCTTTTGCTCAACGTTGCGCACTGAAACGGCACTTACACATCCATACCGGTgagaaaccttttaaatgttcacaatgCGAGAAGGCCTTTACCGAGTTAGGTTCCTTGAAGAGGCACTTACGTGTTCACGGTGGCGACAAATCTTTCAAATGTTCACGCTGCGATAAGGCTTTCGGTTACTCTAGCAGCTTGAAGGATCACTTATGGCTCCATACGGGTGAGAAACCTTTTAAATGCCCGCAGTGCGACAAAACCTTTACCAAGTCGGACAACCTGAAACGGCACTCGTACCTTCATACAGGCGACAAGCCTTTCAAGTGTTCGGAATGTAATAAGGGCTTTACTCGATCTGGTACTTTGAAGAAGCACTCGGTCTACCATGTTTAG
Protein Sequence: MRVTKILACMKTKQEHCIDIEYHPVIKEEIENHASHVCPFCDKRFFTAYRLKVHSLAHTGERPYKCSRCNKTFAQSGTLNRHLLSHANVKPFKCPHCDKAFSQSFGLKRHVRIHAGEKPYTCPQCSKTFIESGALKKHLYIHTDDKPYGCPHCDKAFAQRCALKRHLHIHTGEKPFKCSQCEKAFTELGSLKRHLRVHGGDKSFKCSRCDKAFGYSSSLKDHLWLHTGEKPFKCPQCDKTFTKSDNLKRHSYLHTGDKPFKCSECNKGFTRSGTLKKHSVYHV

Sequence clustering based on sequence similarity using MMseqs2