Cmor009266.1
Basic Information
- Insect
- Cryptocephalus moraei
- Gene Symbol
- Bcl11a
- Assembly
- GCA_946251935.1
- Location
- CAMIUL010000265.1:205309-206472[+]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 5 0.025 47 4.5 0.5 25 39 74 88 58 98 0.68 2 5 0.47 8.7e+02 0.5 0.1 25 44 104 123 97 127 0.78 3 5 0.0016 2.9 8.4 0.2 22 46 129 153 123 155 0.89 4 5 4.6e-05 0.085 13.3 0.1 21 52 156 187 154 187 0.90 5 5 0.0011 2 8.9 0.1 20 48 183 211 180 214 0.90
Sequence Information
- Coding Sequence
- ATGGAGGACAGCGAGGAGTTCCGACGCAGTCTCGAGCCGATGGTCATCATCGACGACCAAGACGACGACGAGGGGGCCGTGCACGAGGGGAACTTCCGGGACTCCTCCCCCGAGCGTCCCCAGATCTCCATAATACCCGTCGTTACGACAGCCACCACTCCGCTCATTACCAGGAAGAGGGAGAAGGGGGCGTCGTCGGTACGACGGTCGAGCCCGCTCGAGAAGTGCCCGATATGCAAGAAGTTCTTCAGGAGGATGCGGACCCATCTGCTCAAGCACGAGATGGACAGCAGGCCGCCGGAGGACAGGTTATGCTGCCCGTTCtgcaagaagatgttcaacacgcagagcaacatggcgatccacatgaggacccatacgggcgacaagccgtacgtctgcgacgtgtgccgcaagtcgttctcgcagagctgcaacctcgtcaaccacctccgcgtccacaccggcgagcgaccgttcaagtgtccgtactgcgaacgggccttcacgcagtccggcaacctgaacaaccacgtcaggctgcacacgtccgagaagccgttcgagtgccacttctgcgacaaggccttcgtccaatctggcaacctgagctcgcacatacgcaacaaccacaggtcggcgtgGAACGGACATATCTAA
- Protein Sequence
- MEDSEEFRRSLEPMVIIDDQDDDEGAVHEGNFRDSSPERPQISIIPVVTTATTPLITRKREKGASSVRRSSPLEKCPICKKFFRRMRTHLLKHEMDSRPPEDRLCCPFCKKMFNTQSNMAIHMRTHTGDKPYVCDVCRKSFSQSCNLVNHLRVHTGERPFKCPYCERAFTQSGNLNNHVRLHTSEKPFECHFCDKAFVQSGNLSSHIRNNHRSAWNGHI
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00392139;
- 90% Identity
- iTF_00392139;
- 80% Identity
- iTF_00392139;