Cses015743.1
Basic Information
- Insect
- Cotesia sesamiae
- Gene Symbol
- -
- Assembly
- None
- Location
- scaffold:5-2667[-]
Transcription Factor Domain
- TF Family
- zf-LITAF-like
- Domain
- zf-LITAF-like domain
- PFAM
- PF10601
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family display a conserved zinc ribbon structure [3] with the motif C-XX-C- separated from the more C-terminal HX-C(P)X-C-X4-G-R motif by a variable region of usually 25-30 (hydrophobic) residues. Although it belongs to one of the zinc finger's fold groups (zinc ribbon), this particular domain was first identified in LPS-induced tumour necrosis alpha factor (LITAF) which is produced in mammalian cells after being challenged with lipopolysaccharide (LPS)[2]. The hydrophobic region probably inserts into the membrane rather than traversing it. Such an insertion brings together the N- and C-terminal C-XX-C motifs to form a compact Zn2+-binding structure [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 4.9e-28 2.2e-24 85.4 11.8 2 69 56 124 55 125 0.97
Sequence Information
- Coding Sequence
- ATGTACAAAAATGGACCACCACCTTCGTATGATGAACCCCCACCATCTGCACCACCCAGTTACTTTCAGAGCGTAGGTGGTGTACCTCCAGCAAGTCCATTTACACCAGCACCAACGTATGCTAATGGACCAACCATTGTGACAACAATAGTACCATTGGGACCTGGACCAACCCATACTATTTGTCCTCATTGTCATGCTGAAATAGAGACTGCTACTAAAACAGAACCTGGAATGATTGCGTATATTTCTGGTGCTGTTATTGCTCTGCTTGGATGCTTCCTGGGATGCTGTCTAATTCCCTGTTGCATTGACGAGTGTATGGATGTACATCACACTTGTCCAAATTGCAAAGCTTATCTTGGACGTCACGGCAGATAA
- Protein Sequence
- MYKNGPPPSYDEPPPSAPPSYFQSVGGVPPASPFTPAPTYANGPTIVTTIVPLGPGPTHTICPHCHAEIETATKTEPGMIAYISGAVIALLGCFLGCCLIPCCIDECMDVHHTCPNCKAYLGRHGR
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00738764;
- 90% Identity
- iTF_00380002; iTF_01299682; iTF_01004742; iTF_00132327; iTF_01000936; iTF_01001768; iTF_00132906; iTF_00996714; iTF_01560810; iTF_00266860; iTF_01002447; iTF_00452274; iTF_00266131; iTF_00997395; iTF_01006708; iTF_01005689; iTF_00317146; iTF_01003898; iTF_00379323; iTF_00131644; iTF_00381532; iTF_00380765; iTF_00687582; iTF_00317791; iTF_01306913; iTF_00460168; iTF_00798952; iTF_00397737; iTF_01129739; iTF_00414733; iTF_00059855; iTF_00398512; iTF_00059121; iTF_01365074; iTF_00841523; iTF_00629492; iTF_01056468; iTF_01497876; iTF_00653269; iTF_00721686; iTF_00058359; iTF_01379704; iTF_00051417; iTF_00905787; iTF_01058043; iTF_00343548; iTF_01057312; iTF_00938338; iTF_00046629; iTF_00048338; iTF_00047644; iTF_00829159; iTF_01509254; iTF_00263951; iTF_00263026; iTF_00829910;
- 80% Identity
- iTF_01004742; iTF_01006708; iTF_01005689; iTF_01003898; iTF_00380765;