Ccon009720.1
Basic Information
- Insect
- Cotesia congregata
- Gene Symbol
- -
- Assembly
- None
- Location
- contig:16209902-16214185[+]
Transcription Factor Domain
- TF Family
- HMG
- Domain
- HMG_box domain
- PFAM
- PF00505
- TF Group
- Other Alpha-Helix Group
- Description
- High mobility group (HMG) box domains are involved in binding DNA, and may be involved in protein-protein interactions as well. The structure of the HMG-box domain consists of three helices in an irregular array. HMG-box domains are found in one or more copies in HMG-box proteins, which form a large, diverse family involved in the regulation of DNA-dependent processes such as transcription, replication, and strand repair, all of which require the bending and unwinding of chromatin. Many of these proteins are regulators of gene expression. HMG-box proteins are found in a variety of eukaryotic organisms, and can be broadly divided into two groups, based on sequence-dependent and sequence-independent DNA recognition; the former usually contain one HMG-box motif, while the latter can contain multiple HMG-box motifs. HMG-box domains can be found in single or multiple copies in the following protein classes: HMG1 and HMG2 non-histone components of chromatin; SRY (sex determining region Y protein) involved in differential gonadogenesis; the SOX family of transcription factors [1]; sequence-specific LEF1 (lymphoid enhancer binding factor 1) and TCF-1 (T-cell factor 1) involved in regulation of organogenesis and thymocyte differentiation [2]; structure-specific recognition protein SSRP involved in transcription and replication; MTF1 mitochondrial transcription factor; nucleolar transcription factors UBF 1/2 (upstream binding factor) involved in transcription by RNA polymerase I; Abf2 yeast ARS-binding factor [3]; yeast transcription factors lxr1, Rox1, Nhp6b and Spp41; mating type proteins (MAT) involved in the sexual reproduction of fungi [4]; and the YABBY plant-specific transcription factors.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 4 5.4 5.9e+03 -1.5 0.0 10 26 28 44 28 54 0.80 2 4 3.1 3.3e+03 -0.7 0.1 44 58 73 87 70 89 0.78 3 4 4.6e-09 5e-06 27.5 1.5 4 58 88 138 85 146 0.84 4 4 7.2 7.8e+03 -1.9 0.6 15 26 155 166 152 170 0.66
Sequence Information
- Coding Sequence
- ATGGACGATGCGGAAAATGACGGCCGAGATTACAGTGAAAATATCGATGAAGGACCAACCAGTAACGTCGAAACCGAGGGCTTTTTCTCCTCGGATAAGAAAGATCCGAATAAAGATGAGGAGCCTGACAAAGACGGTAAAATAAAAACAGAAATAGTGAAGCCCGCGACTATGGCTAAAGGACCCTGTGTATGCAAAAGGAATATGAAGGGCACTAAACATCGCAAGAGAAAATTTAAGCGAAAGTCGAGCAAAGGCCGGTCGCTTAATCCCTTTATTATATTCTATTTGCAAATGTACTACAAAAACCCGAGTAAGTGCGTTACCGAGATCGCCTGTCAGGCTGGAAAAATTTGGAGCAGCATGTCCAAGCAGCAAAAGGAGGAATATATCAAAAAAGCCAAATCTCGTAATGGAAAAGCTTTCAAGACTGAAGATGGTGGCAAAATAAAGAAGGGGAAGAAAAGGAAGAAGATTAAGTCTGAAGATAAAAAAATTAAGAAAAAGAGGAAGGATTGTTGA
- Protein Sequence
- MDDAENDGRDYSENIDEGPTSNVETEGFFSSDKKDPNKDEEPDKDGKIKTEIVKPATMAKGPCVCKRNMKGTKHRKRKFKRKSSKGRSLNPFIIFYLQMYYKNPSKCVTEIACQAGKIWSSMSKQQKEEYIKKAKSRNGKAFKTEDGGKIKKGKKRKKIKSEDKKIKKKRKDC
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00380272;
- 90% Identity
- iTF_00380272; iTF_00379604; iTF_00381824; iTF_00381047;
- 80% Identity
- -