Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 0.00036 1.2 8.9 1.2 15 46 71 102 66 105 0.80

2 6 1.2e-05 0.043 13.6 0.0 22 46 106 130 102 134 0.92

3 6 0.0022 7.8 6.4 0.1 22 45 134 157 131 159 0.86

4 6 0.0096 34 4.3 0.0 21 44 160 183 157 188 0.73

5 6 0.0051 18 5.2 0.1 22 52 189 219 186 220 0.84

6 6 0.065 2.3e+02 1.7 0.1 21 45 216 240 214 243 0.85

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	0.00036	1.2	8.9	1.2	15	46	71	102	66	105	0.80
2	6	1.2e-05	0.043	13.6	0.0	22	46	106	130	102	134	0.92
3	6	0.0022	7.8	6.4	0.1	22	45	134	157	131	159	0.86
4	6	0.0096	34	4.3	0.0	21	44	160	183	157	188	0.73
5	6	0.0051	18	5.2	0.1	22	52	189	219	186	220	0.84
6	6	0.065	2.3e+02	1.7	0.1	21	45	216	240	214	243	0.85

Coding Sequence: ATGGACATAAATAATTCTCCATTTGAAATGAAACTTAAAACTCCATTACACCTAAAATACACCTGTGATAAACCTGATTTAATAAAAAAAGAAAATGAGGATCCTGATCAAATTTCTATAAAAGAAGAATTTTTAATTGATACTAATCTAGTAAAGACAGAAGAAGTTTCTCTGACTCCAGAAGACATTGAATTAATCAAAGCAAAACACCCTACGCAAAAAAACTCCGAAAAAAGACCTTACAAGTGCGACATATGCTCGCATAATTTTCGTCAGAAAAATCAGATCCGCATTCACATGCAAATTCATCTTCGAGAGCAACCTTACTCCTGTGACATTTGCTTTGCTACTTTCAACCTCAAAGGTAATTTAAGCACACATTTAAAAATCCACGAGGAAAAACATCCTCACACTTGCAATATTTGTTCCGCTCAATTTAAAACGGAGCAGCTTCTCGACAACCACTTGCAAAATCATAATGAAAAATCGAGTACTTGTTACTTTTGTTACTCGAAATTTGGGAGTCAGAATCTTCTGAAGGATCACATGCGGATTCACGTGGCAGAAAAAATTCTAACATGTAACATTTGTCACTCAAAGTTCAGCACAACCAGCAGTTTGAAGCAGCACATTAGAATTCATACCGGGGAAAAACCACATCAGTGCGACGTTTGTGAAAAGAGATTCACTGCTAGGTCTAATTATATGAGACACATGAAGACTCATAGTACAAAATAA
Protein Sequence: MDINNSPFEMKLKTPLHLKYTCDKPDLIKKENEDPDQISIKEEFLIDTNLVKTEEVSLTPEDIELIKAKHPTQKNSEKRPYKCDICSHNFRQKNQIRIHMQIHLREQPYSCDICFATFNLKGNLSTHLKIHEEKHPHTCNICSAQFKTEQLLDNHLQNHNEKSSTCYFCYSKFGSQNLLKDHMRIHVAEKILTCNICHSKFSTTSSLKQHIRIHTGEKPHQCDVCEKRFTARSNYMRHMKTHSTK

Sequence clustering based on sequence similarity using MMseqs2