Ctra031981.1
Basic Information
- Insect
- Cosmia trapezina
- Gene Symbol
- HmgD_3
- Assembly
- GCA_905163495.1
- Location
- LR991038.1:303004-303366[+]
Transcription Factor Domain
- TF Family
- HMG
- Domain
- HMG_box domain
- PFAM
- PF00505
- TF Group
- Other Alpha-Helix Group
- Description
- High mobility group (HMG) box domains are involved in binding DNA, and may be involved in protein-protein interactions as well. The structure of the HMG-box domain consists of three helices in an irregular array. HMG-box domains are found in one or more copies in HMG-box proteins, which form a large, diverse family involved in the regulation of DNA-dependent processes such as transcription, replication, and strand repair, all of which require the bending and unwinding of chromatin. Many of these proteins are regulators of gene expression. HMG-box proteins are found in a variety of eukaryotic organisms, and can be broadly divided into two groups, based on sequence-dependent and sequence-independent DNA recognition; the former usually contain one HMG-box motif, while the latter can contain multiple HMG-box motifs. HMG-box domains can be found in single or multiple copies in the following protein classes: HMG1 and HMG2 non-histone components of chromatin; SRY (sex determining region Y protein) involved in differential gonadogenesis; the SOX family of transcription factors [1]; sequence-specific LEF1 (lymphoid enhancer binding factor 1) and TCF-1 (T-cell factor 1) involved in regulation of organogenesis and thymocyte differentiation [2]; structure-specific recognition protein SSRP involved in transcription and replication; MTF1 mitochondrial transcription factor; nucleolar transcription factors UBF 1/2 (upstream binding factor) involved in transcription by RNA polymerase I; Abf2 yeast ARS-binding factor [3]; yeast transcription factors lxr1, Rox1, Nhp6b and Spp41; mating type proteins (MAT) involved in the sexual reproduction of fungi [4]; and the YABBY plant-specific transcription factors.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 1.4e-23 1.9e-20 74.6 0.7 1 66 5 68 5 71 0.96
Sequence Information
- Coding Sequence
- ATGATGGAAAAACCGAAAAGACCGATGTCGGCATACCTGTTGTGGCTGAACAGCGAGCGCGGCAAGATAAAGGCGGAGCACCCCGGCCTGAAGGTGACCGAGGTGGCCAAGAAGGCGGGCGAGCTGTGGCGCTCCATGGACGACAAGACCACGTGGGAGGAGAAGGCGGCCGAGGCCAAGGAGCAGTACGCGCGCGACCTGGAGTGCTTCAACGCCAACGGCGGCGCGCCTCCTCCCAAGAAGGCGCTGAAGAGAGGCGTGGCCAAGGCCAAGCCCGTGAAGGTGAGCCGGAGCAAGGTGAAGAAGGAGCCGTCCGAGGACGAGGACGACGCCGAGGACGACGAGCACGACGACAGCGAGTGA
- Protein Sequence
- MMEKPKRPMSAYLLWLNSERGKIKAEHPGLKVTEVAKKAGELWRSMDDKTTWEEKAAEAKEQYARDLECFNANGGAPPPKKALKRGVAKAKPVKVSRSKVKKEPSEDEDDAEDDEHDDSE*
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00374113; iTF_00425377; iTF_00907041; iTF_01246977; iTF_00237571; iTF_01093091; iTF_00071428; iTF_00237572; iTF_00924676; iTF_00171749; iTF_00124262; iTF_00123369; iTF_00449099; iTF_00036717; iTF_00038765; iTF_00037808; iTF_01094032; iTF_00726353; iTF_00973778; iTF_00364020; iTF_01527221; iTF_00122390; iTF_00147452; iTF_00121437; iTF_01526013; iTF_00017329; iTF_01425057; iTF_01342212; iTF_01031137; iTF_00042626; iTF_00784386; iTF_00907874; iTF_01118306; iTF_00906147; iTF_00043492; iTF_00888260; iTF_01084261; iTF_01192711; iTF_00049896; iTF_00622824; iTF_00041769; iTF_00111657; iTF_01532009; iTF_01533929; iTF_00040810; iTF_01534826; iTF_00810059; iTF_01062795; iTF_00785996; iTF_00809132; iTF_01029260; iTF_01063757; iTF_00785199; iTF_01085231; iTF_00771920; iTF_00850736; iTF_00301169; iTF_00711857; iTF_01064657; iTF_00831218; iTF_00172947; iTF_00300211; iTF_00758163; iTF_00783475; iTF_01533044; iTF_00274421; iTF_00445173; iTF_00851797; iTF_00951829; iTF_01230581; iTF_01538741; iTF_00302102; iTF_00445174; iTF_01117206; iTF_00120503; iTF_00685432; iTF_00928696; iTF_01027320; iTF_00450106; iTF_00273595; iTF_00745692; iTF_01061884; iTF_01285533; iTF_01441085; iTF_00039806; iTF_01026176; iTF_01028288; iTF_00446139; iTF_01119327; iTF_01030223; iTF_01439928; iTF_01260095; iTF_01260094; iTF_01338752; iTF_01340106; iTF_00177117;
- 90% Identity
- iTF_00446139;
- 80% Identity
- -