Basic Information

Transcription Factor Domain

TF Family: E2F
Domain: E2F_TDP domain
PFAM: PF02319
TF Group: Helix-turn-helix
Description: This family contains the transcription factor E2F and its dimerisation partners TDP1 and TDP2, which stimulate E2F-dependent transcription. E2F binds to DNA as a homodimer or as a heterodimer in association with TDP1/2, the heterodimer having increased binding efficiency. The crystal structure of an E2F4-DP2-DNA complex shows that the DNA-binding domains of the E2F and DP proteins both have a fold related to the winged-helix DNA-binding motif. Recognition of the central c/gGCGCg/c sequence of the consensus DNA-binding site is symmetric, and amino acids that contact these bases are conserved among all known E2F and DP proteins.
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 0.00014 1.1 10.3 1.3 24 50 61 91 11 101 0.70

2 6 0.012 98 4.2 0.0 35 50 101 116 90 126 0.80

3 6 0.015 1.2e+02 3.9 0.0 36 50 127 141 116 148 0.82

4 6 0.0026 20 6.3 0.2 28 49 164 190 139 195 0.58

5 6 0.011 87 4.3 0.0 35 50 201 216 189 223 0.77

6 6 0.00017 1.3 10.1 0.3 29 51 241 273 215 278 0.71

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	0.00014	1.1	10.3	1.3	24	50	61	91	11	101	0.70
2	6	0.012	98	4.2	0.0	35	50	101	116	90	126	0.80
3	6	0.015	1.2e+02	3.9	0.0	36	50	127	141	116	148	0.82
4	6	0.0026	20	6.3	0.2	28	49	164	190	139	195	0.58
5	6	0.011	87	4.3	0.0	35	50	201	216	189	223	0.77
6	6	0.00017	1.3	10.1	0.3	29	51	241	273	215	278	0.71

Coding Sequence: ATGGACCCGCACCGATCGGAACAACAATGCCAGCTGATGAGTTCACGCGGACGTATCTTCAGTCGGCGGGAACTCGGCGCAGACTTATTACTAGCACTGTTCACGCAGCGCTGCTTGCGTAATGTGGGTGAAAGGTTCAAGAGAATTTATGACTACAAAAACACAAAGCTGCGCTACTGCTACGCGCTACGATTAGTCTACGAAGTTCTAAACACTGAACACAACGCTCAATGTCGGCGTCGCTACGATGTTGCTGCGGTGTTACGCGCTACGAGTAGTCTGCAATTCACTGAGCACGACGCGCAAAGTCAGCGTCGCTACGATGTTGCTACGGTGTTACGCGCTACGAGTAGTCTGCAATTCACTGAGCACGACGCGCAAAGTCAGCGTCGCTACGATGTTGCTACGGTGTTACGCGCTACGAGTAGTCTGCAATTCACTGAGCACGACGCGCAAAGTCAGCGTCGCTACGATGTTGCTACGGTGTTACGCGCTACGAGTAGTCTGCAATTCACTGAGCACGACGCGCAAAGTCAGCGTCGCTACGATGTTGCTACGGTGTTACGCGCTACGAGTAGTCTGCAATTCACTGAGCACGACGCGCAAAGTCAGCGTCGCTACGATGTTGCTACGGTGCTACGCGCAACGAGTAGTTTACGAAGTTctacaattttattgaatacTACGCGCAACTTAGACGTCGATACAATTTTGCTACGCGCTACCAGTAGTTTACGAAGTTCTAGAATTCACAGAACACGACGCGCAACGTCGCGTCGTCGTCGCTACGATGTTGCTATGGTGCTACGCGCTACAAGTAGTCTACGAAGAGCTATAATGCTATGGCCAGACCTGAgcgtcaagtag
Protein Sequence: MDPHRSEQQCQLMSSRGRIFSRRELGADLLLALFTQRCLRNVGERFKRIYDYKNTKLRYCYALRLVYEVLNTEHNAQCRRRYDVAAVLRATSSLQFTEHDAQSQRRYDVATVLRATSSLQFTEHDAQSQRRYDVATVLRATSSLQFTEHDAQSQRRYDVATVLRATSSLQFTEHDAQSQRRYDVATVLRATSSLQFTEHDAQSQRRYDVATVLRATSSLRSSTILLNTTRNLDVDTILLRATSSLRSSRIHRTRRATSRRRRYDVAMVLRATSSLRRAIMLWPDLSVK

Sequence clustering based on sequence similarity using MMseqs2