Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 0.023 41 3.9 0.3 20 45 5 30 2 33 0.79

2 6 0.0024 4.3 7.0 0.2 21 46 34 59 30 62 0.89

3 6 0.029 51 3.6 0.6 22 40 63 81 60 89 0.76

4 6 5.5e-05 0.098 12.3 0.1 22 44 119 141 114 146 0.89

5 6 0.00088 1.6 8.4 0.0 21 45 146 170 142 179 0.89

6 6 1.3 2.3e+03 -1.7 0.1 21 30 174 183 170 184 0.80

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	0.023	41	3.9	0.3	20	45	5	30	2	33	0.79
2	6	0.0024	4.3	7.0	0.2	21	46	34	59	30	62	0.89
3	6	0.029	51	3.6	0.6	22	40	63	81	60	89	0.76
4	6	5.5e-05	0.098	12.3	0.1	22	44	119	141	114	146	0.89
5	6	0.00088	1.6	8.4	0.0	21	45	146	170	142	179	0.89
6	6	1.3	2.3e+03	-1.7	0.1	21	30	174	183	170	184	0.80

Coding Sequence: ATGCGCAAACATAATGGTGAACGACCTTattcttgtgatgtgtgtaagaaaaGATTCACGTACCGCAGCAGCTTGAATCGTCATCTGCGCAAACATACTGGTGAGCAACCTTATTCTTGTGATTTGTGTGAGAAAAGATTCACACAGCGCTATAGTTTGAAAGAGCATCTACGCGTTCATACTGGGGAGTGCCCTTTTACATGCCGTATATGTAACAAATCATTCAGATCTAGACTTTACTTGAATGTGCATAGTAATATACATAGTGGCAAGTGTCTGTTTTCATGTGATATGTGTAAGAAATCTTTCACATTTCGGTCTGCTTTGTGGCAGCATCTTCATACTCATACTGGGGAACGTCCCTTTTCCTGGCATGTTTGTGAGAAATCATTCAGGCAGACAGCTAACTTGAGGCGTCATCTGTGTACTCACAGTGGAGAGTGTCCGTTTACATGTGGTTTGTGTAAGGAGTCGTTCCGTGATAGAGGGGACTTGAAGAAACATCTGCGCACTCACAGTGGTGAACGTCCTTTCTCTTGTGATTTGTGTAACAAATGA
Protein Sequence: MRKHNGERPYSCDVCKKRFTYRSSLNRHLRKHTGEQPYSCDLCEKRFTQRYSLKEHLRVHTGECPFTCRICNKSFRSRLYLNVHSNIHSGKCLFSCDMCKKSFTFRSALWQHLHTHTGERPFSWHVCEKSFRQTANLRRHLCTHSGECPFTCGLCKESFRDRGDLKKHLRTHSGERPFSCDLCNK

Sequence clustering based on sequence similarity using MMseqs2