Cven003956.1
Basic Information
- Insect
- Coproporus ventriculus
- Gene Symbol
- -
- Assembly
- GCA_027574865.2
- Location
- JAODAH020009637.1:2-1562[+]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 4 9.8e-06 0.058 13.9 0.1 18 43 7 32 4 41 0.90 2 4 0.8 4.7e+03 -1.8 0.0 21 31 38 48 31 62 0.70 3 4 0.034 2e+02 2.6 0.0 20 34 65 79 52 93 0.72 4 4 2e-05 0.12 12.9 0.1 21 47 94 120 87 126 0.90
Sequence Information
- Coding Sequence
- TTACGTGTGCATATGAGAAGACATACTAATGAGAGACCTTATGTTTGTGATATTTGTGGAATGGCATTTAGACAATCAACAGATATGAGAAGCCATCGAAGGACTCATATGGGAGAGAAAAAAGCTTTATGTTTTGTATGTGGCAAAAAACTCTCATCAACTGgtcaATTAAATGTTCATATGCGTTCCCATACCGGAGAAAAACCATTTAAATGCACCATATGTGACAAAAGTTTTtccacaaaaacaattttggttAAACATATTCGTATTCATACTGGAGAACGCCCTTATACATGTAACATATGTAATAAATCCTTCAACCAAGCAAGTACACTAAAAACTCATTTAAACATCCACAGAAACAATAATGCAAAAGAGGAATACGAAGGGGataaatttatctttgaaGAATTGGTAGATACAAATTGTGTAATTATTGATCAAGAAATGGGGACACAATATACAATAGAGACTGTTGGAAATGAAATAGACTTAAGTGAAACTGAACTTAACGTGGTGATGTTGCCTGCACCAGTTCCTTtgctttaa
- Protein Sequence
- LRVHMRRHTNERPYVCDICGMAFRQSTDMRSHRRTHMGEKKALCFVCGKKLSSTGQLNVHMRSHTGEKPFKCTICDKSFSTKTILVKHIRIHTGERPYTCNICNKSFNQASTLKTHLNIHRNNNAKEEYEGDKFIFEELVDTNCVIIDQEMGTQYTIETVGNEIDLSETELNVVMLPAPVPLL
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00369798;
- 90% Identity
- iTF_00369798;
- 80% Identity
- iTF_00369798;