Cnas005120.1
Basic Information
- Insect
- Contarinia nasturtii
- Gene Symbol
- Aef1
- Assembly
- GCA_009176525.2
- Location
- NW:3103392-3109186[-]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 4 0.0034 5.9 6.7 0.1 21 48 23 50 14 54 0.86 2 4 0.00026 0.45 10.3 0.1 21 47 51 77 49 82 0.86 3 4 0.014 25 4.7 0.0 21 47 79 105 77 110 0.84 4 4 7.9e-05 0.14 12.0 0.1 21 52 107 138 102 140 0.89
Sequence Information
- Coding Sequence
- atgaacGTGAAGTTGGAGTCGCATATGTCTAGAGCCCTAAGTCGTGCAATCACAATGACTGTCAGCGCTGAAAAGCCCTTCCAATGTGCTGTATGCGAAAAACAATTCCGTCAGCTTAGTACGCTCACAAACCATTATAAAATCCATACCGGAGAAAAGCCATTCAAATGTCATatATGCGATAAACGATTCAGGCAATCGAGTACGTTGACAAACCATGCAAAAATCCATACAGGAGAGAAACCGTTCAGTTGCAATTATTGCGCAAAACTATTCCGACAACTAAGCACACTAATCAATCATACAAAGATCCACACGGGCGAAAAACCTTTTGAATGCGCTGTGTGCAAAAAACAATTTAGACAGTCTAGTACTCTAAATAATCATATTAAAATCCATGTATCGGATAAGCCATTCTTGCAAGAGTTGCAGGAAGCCCACAGTCGATTTAAGCAGGAGCCACAACAAGACGCAACTATGTGA
- Protein Sequence
- MNVKLESHMSRALSRAITMTVSAEKPFQCAVCEKQFRQLSTLTNHYKIHTGEKPFKCHICDKRFRQSSTLTNHAKIHTGEKPFSCNYCAKLFRQLSTLINHTKIHTGEKPFECAVCKKQFRQSSTLNNHIKIHVSDKPFLQELQEAHSRFKQEPQQDATM
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01351110;
- 90% Identity
- iTF_01351110;
- 80% Identity
- iTF_00367579;