Cvac000538.1
Basic Information
- Insect
- Conistra vaccinii
- Gene Symbol
- LITAF
- Assembly
- GCA_948150665.1
- Location
- OX411324.1:16203449-16205148[-]
Transcription Factor Domain
- TF Family
- zf-LITAF-like
- Domain
- zf-LITAF-like domain
- PFAM
- PF10601
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family display a conserved zinc ribbon structure [3] with the motif C-XX-C- separated from the more C-terminal HX-C(P)X-C-X4-G-R motif by a variable region of usually 25-30 (hydrophobic) residues. Although it belongs to one of the zinc finger's fold groups (zinc ribbon), this particular domain was first identified in LPS-induced tumour necrosis alpha factor (LITAF) which is produced in mammalian cells after being challenged with lipopolysaccharide (LPS)[2]. The hydrophobic region probably inserts into the membrane rather than traversing it. Such an insertion brings together the N- and C-terminal C-XX-C motifs to form a compact Zn2+-binding structure [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 2.3e-26 3.5e-23 82.1 14.3 1 69 51 118 51 119 0.94
Sequence Information
- Coding Sequence
- ATGGCACAGAACAATGGCGAATATGACATCAAGAACGAAGGCATGCCCCCACCATACACAGGAGGCGGGCCACCTCCCGTCGTGACCGCACAACCCGGGGTTGCGTACCAAGGGAATGTAGTTCCCGTGGTCATCGGTAACCAGATGGGCCCCAAACCATCTCCAACAACCTGCCGATCATGCAACCAGCAGATAGTCACAAGAGTTGAACTGAAGTCTTCTACGAAAACCCATTTGTTTGCTCTCTTGCTCTGTATAGTTTTTTGCCCCTGTGTGTGCCTACCCTACTGTATCGGCAGCTGTCACAATGCGGACCACTACTGTCCAAACTGCAACGCTTACCTCGGCAGCTACAGCAACTAA
- Protein Sequence
- MAQNNGEYDIKNEGMPPPYTGGGPPPVVTAQPGVAYQGNVVPVVIGNQMGPKPSPTTCRSCNQQIVTRVELKSSTKTHLFALLLCIVFCPCVCLPYCIGSCHNADHYCPNCNAYLGSYSN
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00037445; iTF_01247727; iTF_00374832; iTF_00148146; iTF_00908467; iTF_00038356; iTF_00831798; iTF_01526685; iTF_00121067; iTF_01193295; iTF_00364579; iTF_00364582; iTF_00906725; iTF_00907548; iTF_00173838; iTF_00929242; iTF_01064300; iTF_00686004; iTF_01062422; iTF_01063416; iTF_00301767; iTF_01065223; iTF_01533608; iTF_01533611; iTF_01533612; iTF_01532693; iTF_01535502; iTF_00445775; iTF_00447833; iTF_00446782; iTF_01085972; iTF_01084806; iTF_00302715; iTF_01534463; iTF_00375931; iTF_01527940;
- 90% Identity
- iTF_01527940;
- 80% Identity
- -