Basic Information

Transcription Factor Domain

TF Family: zf-LITAF-like
Domain: zf-LITAF-like domain
PFAM: PF10601
TF Group: Zinc-Coordinating Group
Description: Members of this family display a conserved zinc ribbon structure [3] with the motif C-XX-C- separated from the more C-terminal HX-C(P)X-C-X4-G-R motif by a variable region of usually 25-30 (hydrophobic) residues. Although it belongs to one of the zinc finger's fold groups (zinc ribbon), this particular domain was first identified in LPS-induced tumour necrosis alpha factor (LITAF) which is produced in mammalian cells after being challenged with lipopolysaccharide (LPS)[2]. The hydrophobic region probably inserts into the membrane rather than traversing it. Such an insertion brings together the N- and C-terminal C-XX-C motifs to form a compact Zn2+-binding structure [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 3 2.6e-05 0.055 14.3 0.1 2 32 28 58 27 65 0.81

2 3 0.0017 3.5 8.5 0.1 2 20 93 111 92 117 0.86

3 3 7.5e-10 1.6e-06 28.9 16.8 2 69 133 195 132 196 0.85

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	3	2.6e-05	0.055	14.3	0.1	2	32	28	58	27	65	0.81
2	3	0.0017	3.5	8.5	0.1	2	20	93	111	92	117	0.86
3	3	7.5e-10	1.6e-06	28.9	16.8	2	69	133	195	132	196	0.85

Coding Sequence: atgacaGAATCAAAAAATACTGCAAAAGTGACCACACCAActggacaaaataaaaaaattgtatattttgctGTCGGACCCAAATCAAATTCTGTTCATTGTCCATTTTGTGATAAAAATGGTGAAACAATTGTTAGTGAAAAAGTTGACTCTTGGGAAAGTGTTAACAGTTGTTTGCAATTAAcattatgGAAAAAAGAATCAAATGTTAAAGATCTATcacatttaacaaattttgtaacaCCATTAGTTggacattatttaaatttaccagATAGTCCAGCTATTGTTCAATGTCCAAGTTGTGGTGTTACAGCAGAAACAATTTATGAAATGGTATTTACACCATCAGCTGAACGTGTTGTTAGCATTCCACCAAATAGTGTGCTTGGCACTGAACCTCAAGAAATTTTATGTCCATCATGTTTTAAAAATGGATTATCAATTACAAGAGTGGAAGCATCAACTTTTACTCAACGtatgatttcatattttgagAAATGTTGCTGttttaaatgtaCTTGGCGTTGTAGTAAGGACTTAAATCATTATTGTTGTCATTGCGGTTGCTTTATTGGACGTCATATTGAAGTTGGTTATTTTCAAGAGAAAACATTAAAGAAacataaatcaaattcaaaaattggaagatttaataaaatgattgaaataCCATCAAAGAAATCAAAACCATCGAAAACTAATGTAAATACAGAAactgctttttaa
Protein Sequence: MTESKNTAKVTTPTGQNKKIVYFAVGPKSNSVHCPFCDKNGETIVSEKVDSWESVNSCLQLTLWKKESNVKDLSHLTNFVTPLVGHYLNLPDSPAIVQCPSCGVTAETIYEMVFTPSAERVVSIPPNSVLGTEPQEILCPSCFKNGLSITRVEASTFTQRMISYFEKCCCFKCTWRCSKDLNHYCCHCGCFIGRHIEVGYFQEKTLKKHKSNSKIGRFNKMIEIPSKKSKPSKTNVNTETAF

Sequence clustering based on sequence similarity using MMseqs2