Basic Information

Transcription Factor Domain

TF Family: BTB
Domain: zf-C2H2|ZBTB
PFAM: PF00651
TF Group: Zinc-Coordinating Group
Description: The BTB (for BR-C, ttk and bab) [6] or POZ (for Pox virus and Zinc finger) [1] domain is present near the N-terminus of a fraction of zinc finger (Pfam:PF00096) proteins and in proteins that contain the Pfam:PF01344 motif such as Kelch and a family of pox virus proteins. The BTB/POZ domain mediates homomeric dimerisation and in some instances heteromeric dimerisation [1]. The structure of the dimerised PLZF BTB/POZ domain has been solved and consists of a tightly intertwined homodimer. The central scaffolding of the protein is made up of a cluster of alpha-helices flanked by short beta-sheets at both the top and bottom of the molecule [2]. POZ domains from several zinc finger proteins have been shown to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes including N-CoR and SMRT [5, 3, 4]. The POZ or BTB domain is also known as BR-C/Ttk or ZiN.
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 4 0.011 4.4 8.3 0.0 70 108 1 46 1 48 0.82

2 4 0.091 35 5.4 0.1 78 109 48 79 45 80 0.91

3 4 1.1e-20 4.1e-18 66.4 0.0 8 105 139 238 132 243 0.85

4 4 8.2 3.2e+03 -0.9 0.0 72 100 237 265 233 273 0.79

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	4	0.011	4.4	8.3	0.0	70	108	1	46	1	48	0.82
2	4	0.091	35	5.4	0.1	78	109	48	79	45	80	0.91
3	4	1.1e-20	4.1e-18	66.4	0.0	8	105	139	238	132	243	0.85
4	4	8.2	3.2e+03	-0.9	0.0	72	100	237	265	233	273	0.79

Coding Sequence: TACATTTACACGGATCGCATCGACCTGAAGGACTCGTATAGCAAGAACATCATCATACTCATCACGGACATATACCAGCTGGCTGGTTTGTTCACAATGCCGCGCCTAGCTCATGGCTGCATACAGTATCTCGACTACAAGATCAACAAGGCCAACGTGTTGGAGGCTTTGTACAACGCAGATAAGAGCAAcattaaaataatcaaagatCATTGCATGCAATTCATCATCAAGGAGGAAAACTACACCGAGGTGGTTATGTCCAGCGAGTTTGGGGACTTGGACAAGCCACTGCTGGTAGAAATTATACGCAAGCGCCTACATCCCAGTAAACTGGTCATGGACACCAGTTTTGAGTCTAACATCGGTACCACTTTGGAAACCGATTTGTCTGCTTTCTTGGAAACCACTGGGAAAGATTTCTGTGACATAAGCCTAATACTGGAAGATCATGTGATTCCGGCCCACAAATCTGTGTTATCAGCTCGTTGCACCTATTTTCAAGGCATGTTTCGGTCATTCATGCCGCCAGATAACACAGTCAATATACAAATTGGCGAGATTTCACCATCGTTGGAGGCGTTTCAATCGCTGCTGAGGTACATATACTATGGAGAAACGAAGATGCCGCCACAGGATGCACTGTATCTGTTCCAGGCACCGTGCTTCTATGGACTGGCCAACAACCGTTTGCATGCCTTCTGCAAATACTCGCTGGAGCACAATATAACGTATGAGAATGTCTTGCAGACACTGGAGGCGTCAGATATAACCAAAATCTATGACATCAAGGAGTATGCGTTGAAATTGATTGTCAAAGATTTTGCCAAGGTGGCCAGGTTGCCAAAGATAGCCGGCCTGTCGCGCGAACTGTTGCTGGAGATAATACGCGCTGTGGCCGATTCGCACGGCGAGTTTCTGACCCGCATCAATATCAATACAGATATCTGA
Protein Sequence: YIYTDRIDLKDSYSKNIIILITDIYQLAGLFTMPRLAHGCIQYLDYKINKANVLEALYNADKSNIKIIKDHCMQFIIKEENYTEVVMSSEFGDLDKPLLVEIIRKRLHPSKLVMDTSFESNIGTTLETDLSAFLETTGKDFCDISLILEDHVIPAHKSVLSARCTYFQGMFRSFMPPDNTVNIQIGEISPSLEAFQSLLRYIYYGETKMPPQDALYLFQAPCFYGLANNRLHAFCKYSLEHNITYENVLQTLEASDITKIYDIKEYALKLIVKDFAKVARLPKIAGLSRELLLEIIRAVADSHGEFLTRININTDI

Sequence clustering based on sequence similarity using MMseqs2