Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.0001 0.43 10.7 0.1 16 51 23 58 14 61 0.85

2 5 0.00017 0.73 9.9 0.1 23 45 58 80 55 83 0.89

3 5 0.0024 10 6.2 0.3 20 43 83 106 79 111 0.87

4 5 0.017 72 3.6 0.1 21 44 112 135 107 143 0.86

5 5 0.00057 2.4 8.3 0.0 23 45 142 164 138 170 0.91

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.0001	0.43	10.7	0.1	16	51	23	58	14	61	0.85
2	5	0.00017	0.73	9.9	0.1	23	45	58	80	55	83	0.89
3	5	0.0024	10	6.2	0.3	20	43	83	106	79	111	0.87
4	5	0.017	72	3.6	0.1	21	44	112	135	107	143	0.86
5	5	0.00057	2.4	8.3	0.0	23	45	142	164	138	170	0.91

Coding Sequence: ATGTATACATGCAAACGGTGTAACAAGATATTCCCCTGTAAACGTGATCAACTATTACACAAAAAAGAAGTGCACTCCCAAACAAAATCCTCCTACGAATGTAAAatctgttcaaaatatttttgcaacagTGGCAATTTGGAACGTCACATGAAGGTACACAATGATGTACGACCATTTGTTTGTCGTATTTGTGGTAAAGCCTTTGCACAGTCTGTTAATTTAAATCGTCACTATTCCGTACATAACGGCGAACGTCCGTATCCATGTACATTTTGTGCGAAAACCTTTACACAACAATCAAACATGCAACGCCATCAGCTAACACATACGGGAGAGAAACCATTTCGTTGTAAACGTTGTGGACGTTATTTCTCACAGCGTGTTAACCTTAAAAAGCATATTATGGGTCATTTGAATACAAAACCGTACACGTGCAAAATATGTCAAAAATCTTTCATACAATTgggtaattttaaaaaacatttacagTCACATGTCAAGGATGGCATAGAGATCGATATGAAGGCGATAGTGGCCGAGGCACAGGCATTGGCAAAACAAAGTTTAGAAATGGCCGATGATCAACCTGTTGGGTTTGAATGTTGTCTACAGTCGtttgattttcaataa
Protein Sequence: MYTCKRCNKIFPCKRDQLLHKKEVHSQTKSSYECKICSKYFCNSGNLERHMKVHNDVRPFVCRICGKAFAQSVNLNRHYSVHNGERPYPCTFCAKTFTQQSNMQRHQLTHTGEKPFRCKRCGRYFSQRVNLKKHIMGHLNTKPYTCKICQKSFIQLGNFKKHLQSHVKDGIEIDMKAIVAEAQALAKQSLEMADDQPVGFECCLQSFDFQ

Sequence clustering based on sequence similarity using MMseqs2