Cdip016956.1
Basic Information
- Insect
- Cloeon dipterum
- Gene Symbol
- -
- Assembly
- GCA_949628265.1
- Location
- OX451263.1:29272289-29273008[+]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 5 0.011 35 4.7 0.0 26 43 91 108 82 113 0.85 2 5 0.00094 2.9 8.1 0.0 18 44 111 137 108 141 0.85 3 5 8e-05 0.25 11.5 0.1 22 53 143 174 140 175 0.90 4 5 0.013 40 4.5 0.0 22 44 178 200 175 207 0.90 5 5 0.035 1.1e+02 3.1 0.0 19 46 204 231 201 236 0.84
Sequence Information
- Coding Sequence
- ATGAGGTCTGGAAAGGTGCAGCTGCTGGTCGGCGTTGATGGAACGCCGCTTTTCGGTTGCCCAGAGTGCAACATGGCTTTCCCAGTCAAAGATCTTCTTGAACAACATGTTTGTCTAAAACAATCAGTTGCTTCCCCTGAGGCTATGGAAGATGCTGATGTTACACATTATGGCCAAAGGCTGTTCGGTTGCCAACAGTGCAACATGGAATTCCCAAACAACCATCTGCTTGAACAACATCTTCATGATTCTCACCAACTCTCTAAGTTTATCTGTGACATTTGCGGTGCGGTAttgaaacacaaacaaaacgtGTTGGCGCACAAGAAAAAACACAACTCTGAGCGGCCGTTCACCTGTTCGGTGTGCAATAAGGGATTCAAGCTCAAGCAATATCTGAAGGACCACCTACTCATTCACTCAGGTGAGAAGAAGCACGTCTGTCCAGTATGCGGCAATGGCTTTACCCAAAAAAACCACATGCAACGACACTTAAGCAACAAGCACCCCACCAAGAATGGTGACACACCTGAGCGGCCGTTCAACTGTTCGGTGTGCAATAAGGGATTTAAGCGCAGGGACAACCTGAAGCAGCACTTCGTCATTCACTCGTCAGATGAGAACAAGCACCTCTGTCCTGAATGTGGCAAGGCCTTCAACCAAAAAGGAAACATGAACCAACATGTACGCAAGTGGCACCCgtcacatcaaaagaaataa
- Protein Sequence
- MRSGKVQLLVGVDGTPLFGCPECNMAFPVKDLLEQHVCLKQSVASPEAMEDADVTHYGQRLFGCQQCNMEFPNNHLLEQHLHDSHQLSKFICDICGAVLKHKQNVLAHKKKHNSERPFTCSVCNKGFKLKQYLKDHLLIHSGEKKHVCPVCGNGFTQKNHMQRHLSNKHPTKNGDTPERPFNCSVCNKGFKRRDNLKQHFVIHSSDENKHLCPECGKAFNQKGNMNQHVRKWHPSHQKK
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00344586;
- 90% Identity
- iTF_00344586;
- 80% Identity
- iTF_00344586;