Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.011 35 4.7 0.0 26 43 91 108 82 113 0.85

2 5 0.00094 2.9 8.1 0.0 18 44 111 137 108 141 0.85

3 5 8e-05 0.25 11.5 0.1 22 53 143 174 140 175 0.90

4 5 0.013 40 4.5 0.0 22 44 178 200 175 207 0.90

5 5 0.035 1.1e+02 3.1 0.0 19 46 204 231 201 236 0.84

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.011	35	4.7	0.0	26	43	91	108	82	113	0.85
2	5	0.00094	2.9	8.1	0.0	18	44	111	137	108	141	0.85
3	5	8e-05	0.25	11.5	0.1	22	53	143	174	140	175	0.90
4	5	0.013	40	4.5	0.0	22	44	178	200	175	207	0.90
5	5	0.035	1.1e+02	3.1	0.0	19	46	204	231	201	236	0.84

Coding Sequence: ATGAGGTCTGGAAAGGTGCAGCTGCTGGTCGGCGTTGATGGAACGCCGCTTTTCGGTTGCCCAGAGTGCAACATGGCTTTCCCAGTCAAAGATCTTCTTGAACAACATGTTTGTCTAAAACAATCAGTTGCTTCCCCTGAGGCTATGGAAGATGCTGATGTTACACATTATGGCCAAAGGCTGTTCGGTTGCCAACAGTGCAACATGGAATTCCCAAACAACCATCTGCTTGAACAACATCTTCATGATTCTCACCAACTCTCTAAGTTTATCTGTGACATTTGCGGTGCGGTAttgaaacacaaacaaaacgtGTTGGCGCACAAGAAAAAACACAACTCTGAGCGGCCGTTCACCTGTTCGGTGTGCAATAAGGGATTCAAGCTCAAGCAATATCTGAAGGACCACCTACTCATTCACTCAGGTGAGAAGAAGCACGTCTGTCCAGTATGCGGCAATGGCTTTACCCAAAAAAACCACATGCAACGACACTTAAGCAACAAGCACCCCACCAAGAATGGTGACACACCTGAGCGGCCGTTCAACTGTTCGGTGTGCAATAAGGGATTTAAGCGCAGGGACAACCTGAAGCAGCACTTCGTCATTCACTCGTCAGATGAGAACAAGCACCTCTGTCCTGAATGTGGCAAGGCCTTCAACCAAAAAGGAAACATGAACCAACATGTACGCAAGTGGCACCCgtcacatcaaaagaaataa
Protein Sequence: MRSGKVQLLVGVDGTPLFGCPECNMAFPVKDLLEQHVCLKQSVASPEAMEDADVTHYGQRLFGCQQCNMEFPNNHLLEQHLHDSHQLSKFICDICGAVLKHKQNVLAHKKKHNSERPFTCSVCNKGFKLKQYLKDHLLIHSGEKKHVCPVCGNGFTQKNHMQRHLSNKHPTKNGDTPERPFNCSVCNKGFKRRDNLKQHFVIHSSDENKHLCPECGKAFNQKGNMNQHVRKWHPSHQKK

Sequence clustering based on sequence similarity using MMseqs2