Clec002661.1
Basic Information
- Insect
- Cimex lectularius
- Gene Symbol
- Ssb-c31a
- Assembly
- GCA_000648675.3
- Location
- NW:1074205-1076800[+]
Transcription Factor Domain
- TF Family
- PC4
- Domain
- PC4 domain
- PFAM
- PF02229
- TF Group
- Unclassified Structure
- Description
- This domain is found at the C-terminal end of Activated RNA polymerase II transcriptional coactivator p15 from humans, YdbC from Lactococcus lactis, and other PC4 family members. p15 has a bipartite structure composed of an N-terminal regulatory domain and a carboxy-terminal cryptic DNA-binding domain [1-4]. Activity is controlled by protein kinases that target the regulatory domain.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 2 0.16 1.8e+03 -2.1 0.0 26 37 10 22 9 22 0.70 2 2 8.9e-28 1e-23 81.9 0.4 1 52 48 99 48 99 0.98
Sequence Information
- Coding Sequence
- ATGCCTGAGACGAAATCAGACTCGGAATATTCAGATTCTGGCTCGGAGGAGAGGCCAGTCAAAAAACAAAAGGTCGAGAAGTCAAAGCCGAAGCCAAAGCCCAAGCCGTCGAAGCAGCGCGATGAGGACGAAGAGCCGTCCTGGTCCCTCGACAACAGGCGTTTCATCAAGGTGCGTGAGTTTAGAGGCAAAGTGATGATCGACATAAGGGAGTACTACGAAAGAGACGGCGACCTCCTCCCTGGCAAAAAGGGCATCTGCCTCTCTACAATCCAATGGAACAAGCTTAAAGACATCATGTCCGAGGTCGATGAGGccatacagaaaaaataa
- Protein Sequence
- MPETKSDSEYSDSGSEERPVKKQKVEKSKPKPKPKPSKQRDEDEEPSWSLDNRRFIKVREFRGKVMIDIREYYERDGDLLPGKKGICLSTIQWNKLKDIMSEVDEAIQKK
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -