Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 0.22 3.5e+03 -0.4 0.0 26 45 55 74 48 76 0.84

2 6 6.9e-05 1.1 10.8 0.1 23 44 80 101 76 105 0.91

3 6 2.6e-06 0.041 15.4 0.0 20 48 105 132 101 137 0.82

4 6 0.011 1.7e+02 3.8 0.1 21 45 134 158 131 161 0.90

5 6 0.00015 2.4 9.7 0.1 20 48 161 189 159 192 0.91

6 6 0.15 2.5e+03 0.1 0.1 22 34 199 211 194 221 0.74

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	0.22	3.5e+03	-0.4	0.0	26	45	55	74	48	76	0.84
2	6	6.9e-05	1.1	10.8	0.1	23	44	80	101	76	105	0.91
3	6	2.6e-06	0.041	15.4	0.0	20	48	105	132	101	137	0.82
4	6	0.011	1.7e+02	3.8	0.1	21	45	134	158	131	161	0.90
5	6	0.00015	2.4	9.7	0.1	20	48	161	189	159	192	0.91
6	6	0.15	2.5e+03	0.1	0.1	22	34	199	211	194	221	0.74

Coding Sequence: ATGGCTCAAGAAGAAAGTGCAGATCTGAAACAGGCAGCACTTACCCCCGAATTGAAACCAAATTACGTATGCCGAAGatgtaaaattTCATTCGATTTCAAACGAGATTTATTGTTGCACAATAAACAAATGCACACGTTAAGTCCGGAAAATAGCAAATTCGTATGTGAAATATGTAACAAAGGTTTTGTAAACCTTGGAAACATGTATCGACACCTAAAAGGACACGGTGATATACGTCCTCACACGTGCGAAATATGTGGAAAAGCATTTGCTCAAGCAGTGAATTTGCAAAGACACCAGTCTGTGCATACTGGCGAGAGACCGTTTACATGCACGATTTGCAATAAAAGTTTTACACAACCTGGAAACTTAAAACGCCATGAACTTCTACATACGGGTGAAAAACCATTCAGATGTAAGCGATGTGGACGATTGTTTTCACAGCGCATTAATTTAAAGAAACACGTTATGATGCATCAGGGGTATAGACCATATTCATGCGAAATATGCAGCAAATCATTTTTGCAGGCACAGAATTACAAGAAACATATGTTAATGAAGCATGCTGATGTCGAAGTTAAAGTTGAGCAGGAGGAATGTTATGCATGTGCCATATGTACAACAGTGTTTGACAACTTCGCAGACTTCCAATCACATGAAATATTCTGCGAAGTTGCTGGTGAGGAACAGATAGAAACAACAACCAATGGAATCGATTCATCGACTGTAAATGCTTAA
Protein Sequence: MAQEESADLKQAALTPELKPNYVCRRCKISFDFKRDLLLHNKQMHTLSPENSKFVCEICNKGFVNLGNMYRHLKGHGDIRPHTCEICGKAFAQAVNLQRHQSVHTGERPFTCTICNKSFTQPGNLKRHELLHTGEKPFRCKRCGRLFSQRINLKKHVMMHQGYRPYSCEICSKSFLQAQNYKKHMLMKHADVEVKVEQEECYACAICTTVFDNFADFQSHEIFCEVAGEEQIETTTNGIDSSTVNA

Sequence clustering based on sequence similarity using MMseqs2