Ctib002866.1
Basic Information
- Insect
- Chorisops tibialis
- Gene Symbol
- -
- Assembly
- GCA_963669355.1
- Location
- OY770262.1:61466688-61467251[+]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 5 0.035 2.1e+02 3.5 0.2 27 48 22 42 15 48 0.78 2 5 0.0029 18 6.9 0.0 21 43 72 94 63 96 0.86 3 5 0.0026 16 7.1 0.1 13 46 92 125 88 132 0.89 4 5 0.051 3.1e+02 3.0 0.2 21 45 128 152 124 156 0.88 5 5 4.1e-06 0.025 16.1 0.2 21 45 156 180 152 186 0.85
Sequence Information
- Coding Sequence
- ATGGACTTTGAAAAACACCTACACATTCATGCCTTTCCCGATTCGTCAGGTACCCGATATCCTTGCAGAGTATGCGGTAAGGAATTTAAATCACGAGGCGATTtacgtcggcatatgctacgtcATGCTAACATAAAACCATACAAGTGTATTTATTGCATTAAGGGATTCGTCACGAAAAATGAACTGCAAACTCATCTACGCTCGCATACCGGCGAACATCCGTATGAATGTGATTTATGTTTTGCCTCCTTTACAACATCGAGTTCAATGAAAAAGCATCGAAGTAAGCATACGGGCGAAACACGCTATTCCTGTTACATTTGTTCGAAAAAGTATTTCGATTCGTACGCATTGAATCGACATATTATGATGCATACAGGAGAAAGACCGTTTCATTGTAGCGTCTGTAATCGGGGATTTTGTCAGCGCGGCGATATGAGAGTTCACATGCGAATTCATACCGACGAGAGACCGTTTGAATGTCCCATATGTTTTGTAACGTTCAAACAGTCGAGCAATAGGAATGCACATTTTAAGCGTCACACCAGTCAAGCTCAGTAG
- Protein Sequence
- MDFEKHLHIHAFPDSSGTRYPCRVCGKEFKSRGDLRRHMLRHANIKPYKCIYCIKGFVTKNELQTHLRSHTGEHPYECDLCFASFTTSSSMKKHRSKHTGETRYSCYICSKKYFDSYALNRHIMMHTGERPFHCSVCNRGFCQRGDMRVHMRIHTDERPFECPICFVTFKQSSNRNAHFKRHTSQAQ
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00324786;
- 90% Identity
- iTF_00324786;
- 80% Identity
- iTF_00324786;