Cten002183.1
Basic Information
- Insect
- Chironomus tentans
- Gene Symbol
- T13F2.2
- Assembly
- GCA_963573255.1
- Location
- OY754302.1:25804276-25804691[+]
Transcription Factor Domain
- TF Family
- PC4
- Domain
- PC4 domain
- PFAM
- PF02229
- TF Group
- Unclassified Structure
- Description
- This domain is found at the C-terminal end of Activated RNA polymerase II transcriptional coactivator p15 from humans, YdbC from Lactococcus lactis, and other PC4 family members. p15 has a bipartite structure composed of an N-terminal regulatory domain and a carboxy-terminal cryptic DNA-binding domain [1-4]. Activity is controlled by protein kinases that target the regulatory domain.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 3.1e-25 2.1e-21 75.3 0.5 3 51 57 107 55 108 0.93
Sequence Information
- Coding Sequence
- ATGTCGAATAAACGTGTTCACAACCGAAATAATGAGCAAACAAGCTCTGAAGATGAGGATATTAAAccaaaaaaattgaaaagtgaaaaaatgcCTGAAAAGACGAAAGTTAAATCCAGTTATGTTCCAGAAAAGGAAGTTGATGATGAAGGATGTGAATATTATTCACTTGGAAGAGGTCGTCGTATTTCTTTGTCGTCATTTAAGGGAAAACGCTTAATTAATATTCGTGAATATTATGAAGATAAGAAAAGTGGAGAAATGAAACCTGGAAAGAAAGGAATAACTTTAAATCCAGTTGAATGGAAGAACTTATTGGCTGTCGCTGATCAATTTCACATTTCTCCGGAAGAATAA
- Protein Sequence
- MSNKRVHNRNNEQTSSEDEDIKPKKLKSEKMPEKTKVKSSYVPEKEVDDEGCEYYSLGRGRRISLSSFKGKRLINIREYYEDKKSGEMKPGKKGITLNPVEWKNLLAVADQFHISPEE
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00320611;
- 90% Identity
- iTF_00320611;
- 80% Identity
- -