Basic Information

Insect: Cheilosia vernalis
Gene Symbol: bs
Assembly: GCA_949126925.1
Location: OX421362.1:54945865-54979541[+]

Transcription Factor Domain

TF Family: SRF
Domain: SRF domain
PFAM: PF00319
TF Group: Helix-turn-helix
Description: Serum response factor (SRF) is a ubiquitous nuclear protein important for cell proliferation and differentiation. SRF function is essential for transcriptional regulation of numerous growth-factor-inducible genes, such as c-fos oncogene and muscle-specific actin genes. A core domain of around 90 amino acids is sufficient for the activities of DNA-binding, dimerisation and interaction with accessory factors. Within the core is a DNA-binding region, designated the MADS box [2], that is highly similar to many eukaryotic regulatory proteins: among these are MCM1, the regulator of cell type-specific genes in fission yeast; DSRF, a Drosophila trachea development factor; the MEF2 family of myocyte-specific enhancer factors; and the Agamous and Deficiens families of plant homeotic proteins. In SRF, the MADS box has been shown to be involved in DNA-binding and dimerisation [1]. Proteins belonging to the MADS family function as dimers, the primary DNA-binding element of which is an anti-parallel coiled coil of two amphipathic α-helices, one from each subunit. The DNA wraps around the coiled coil allowing the basic N-termini of the helices to fit into the DNA major groove. The chain extending from the helix N-termini reaches over the DNA backbone and penetrates into the minor groove. A 4-stranded, anti-parallel β-sheet packs against the coiled-coil face opposite the DNA and is the central element of the dimerisation interface. The MADS-box domain is commonly found associated with K-box region see (IPR002487).
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 1 1.6e-24 1.3e-20 73.4 0.1 1 48 180 227 180 227 0.98

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	1	1.6e-24	1.3e-20	73.4	0.1	1	48	180	227	180	227	0.98

Sequence Information

Coding Sequence: ATGGATCCTTCGCGAGGTGACTCGCGGTACAATCTGAACTACAGTATGAGCAGTATAGGGCTCAGTCTGGCGGATCAGACCGACATTTATGGCAACCCTGGTGCGGCGGCTGCACTGGGCGGGCGACCACCCAGTGGAGGGTTGATACAGCCGATGGGTGGCGGAAGTGCTGGTGGTGGAGGAGGTGGCAGAGGGGGAGGTGGTGGTCTAATGTCAAACTCAAGTCAGTGTCAATCGCTGAGCAACACGGGCAACACAAGTGGCGGCGGCGGTGGACAATCGCGAGGTGTTAAACGTACTAGTTCAGATTGTTATGACGACCATCATCGCGGGGGCAGTGGTACTGGTGGAATGACTTCGCAATCGTTGCAAGGACTCGAATCGTGTGCCGGTGGCAGCGGCAATGGAACCAATCCAGGTGGCCAGCAGGGCAACGTGCCTGATGTCGTCGATGACAGCTACACTTCCTTGCAGAACAAGAAATCACCACCGGCCAACGGCAAGAAAACAAAAGGTCGTGTCAAAATCAAAATGGAATACATCGACAACAAATTGCGGCGGTATACGACGTTTTCTAAGAGGAAAACTGGAATCATGAAGAAGGCGTACGAGCTTTCCACGCTGACGGGCACTCAAGTAATGCTGTTGGTGGCATCGGAAACCGGGCACGTGTACACATTTGCGACGCGCAAACTTCAGCCGATGATCACCTCAGAGGCGGGCAAACAACTGATCCAGACCTGCCTGAATTCGCCAGATCCGCCGAGTGTGGGTGGCGGCGATCAACGCATGTCAGCGACCGGATTCGAGGAAACCGAACTAAGTTACAATATAGCCGACGAGGACTCAAAAGTAAGACAATTAATTTATGGTCACCATGGTCACGCTCATCTCGGTCATCCGCAAGCTCCCAGTCATTACGGCTTGGAACAGAGTATAATGCAGTCGCCGTATTCGTCCGGTGGTCAGCCGTCGCCGCTGTCGCATGCGCAGGGCTACCCGCCCCATGGGGGCCATTCGCATCACTCGCACGTGCCACATGTGCCCCATTCGACTCATTCGCACATGACGCATGCGCATGCGCAGCGGTAA
Protein Sequence: MDPSRGDSRYNLNYSMSSIGLSLADQTDIYGNPGAAAALGGRPPSGGLIQPMGGGSAGGGGGGRGGGGGLMSNSSQCQSLSNTGNTSGGGGGQSRGVKRTSSDCYDDHHRGGSGTGGMTSQSLQGLESCAGGSGNGTNPGGQQGNVPDVVDDSYTSLQNKKSPPANGKKTKGRVKIKMEYIDNKLRRYTTFSKRKTGIMKKAYELSTLTGTQVMLLVASETGHVYTFATRKLQPMITSEAGKQLIQTCLNSPDPPSVGGGDQRMSATGFEETELSYNIADEDSKVRQLIYGHHGHAHLGHPQAPSHYGLEQSIMQSPYSSGGQPSPLSHAQGYPPHGGHSHHSHVPHVPHSTHSHMTHAHAQR

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_00257788;
90% Identity: iTF_00311783; iTF_00671559; iTF_00672183; iTF_01521049; iTF_01522632; iTF_01521851; iTF_00976446; iTF_01223394; iTF_00310218; iTF_00389587; iTF_00724758; iTF_00688632; iTF_00991775; iTF_01395807; iTF_01541407; iTF_01542181;
80% Identity: -