Basic Information

Transcription Factor Domain

TF Family: BTB
Domain: zf-C2H2|ZBTB
PFAM: PF00651
TF Group: Zinc-Coordinating Group
Description: The BTB (for BR-C, ttk and bab) [6] or POZ (for Pox virus and Zinc finger) [1] domain is present near the N-terminus of a fraction of zinc finger (Pfam:PF00096) proteins and in proteins that contain the Pfam:PF01344 motif such as Kelch and a family of pox virus proteins. The BTB/POZ domain mediates homomeric dimerisation and in some instances heteromeric dimerisation [1]. The structure of the dimerised PLZF BTB/POZ domain has been solved and consists of a tightly intertwined homodimer. The central scaffolding of the protein is made up of a cluster of alpha-helices flanked by short beta-sheets at both the top and bottom of the molecule [2]. POZ domains from several zinc finger proteins have been shown to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes including N-CoR and SMRT [5, 3, 4]. The POZ or BTB domain is also known as BR-C/Ttk or ZiN.
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 3 3 2e+03 0.1 0.0 85 104 31 50 24 55 0.83

2 3 1.6e-22 1.1e-19 71.8 0.0 6 107 127 229 124 232 0.91

3 3 1.5 9.8e+02 1.1 0.1 77 109 231 263 227 264 0.87

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	3	3	2e+03	0.1	0.0	85	104	31	50	24	55	0.83
2	3	1.6e-22	1.1e-19	71.8	0.0	6	107	127	229	124	232	0.91
3	3	1.5	9.8e+02	1.1	0.1	77	109	231	263	227	264	0.87

Coding Sequence: ATGATGTTGCTTACGATGGTCAATTGGTTTGCAGATATAACGATGGAGCTTCGAGGGCTGAGGGTTCCGTGGACGTTGCACTGTTGGATGCACAGCCTGTCTACGGCCCACGAGATGCGAATAGACTCGGTGATCGATCAGCTTCTGCAAGACTTTCTGCAAGTCTGCCCCGACGATTATTCGACGCAGTTCGCTCAAGAGTGCCTTCCCTTACTCTTCAACATCTTTCGCTACAGCAAGCTATCCACGGTTGACAATaAGGAGGGCACGACGCTATTATTGGCCGACATATTTTGTACCTGTTTCGGCTGGGAGCCGATAAAGCCAATTAGAGATACGAGCCTGTCCAGTGGATCGAGAATAGATCCAAAGTTCGTCAATAATCCAGAATTGAGTGACGTTCAGTTCCGAGTGGAAGGCCGAGTCTTTTACGGCCATAAGATCGTTCTTGTCACGTCGTCGGCGAGATTCAGGAATATGTTGAGCTCGAAGCTGTGCGAGGGAAATCCGCCAATTGTCCAAATTAACGACATTCGATACCACATTTTCCAGTTGGTCATGGAGTTTTTGTATCACGGCGGCTGCGCTACGCTGGACGTCAATCAAAGCGACGTTCTCGAGTTGATGGCGGCTGCGAATTTCTTCCAGTTGGATGGCTTGTTACGATTTTGCGAAGCACAGTGCTCAACGATGGTCGACCTCGACAACATTGTATCCATGTACATTCATGCCAAGgTGTACAATGCAGTACAATTGCTCGAATACTGTCAAGGATTTTTGCTGCAAAATATGGTAGCACTTCTTACATACGACGACTCGGTAAAGCGATTATTGTTTGCTAAAAAGCTACCAAATCACGATGTGCTTGCTGGTCTTCTTTTAACATTACAAGCTAGAATAAAAGCCAGAAGACCGCAGAACGTAAAATAA
Protein Sequence: MMLLTMVNWFADITMELRGLRVPWTLHCWMHSLSTAHEMRIDSVIDQLLQDFLQVCPDDYSTQFAQECLPLLFNIFRYSKLSTVDNKEGTTLLLADIFCTCFGWEPIKPIRDTSLSSGSRIDPKFVNNPELSDVQFRVEGRVFYGHKIVLVTSSARFRNMLSSKLCEGNPPIVQINDIRYHIFQLVMEFLYHGGCATLDVNQSDVLELMAAANFFQLDGLLRFCEAQCSTMVDLDNIVSMYIHAKVYNAVQLLEYCQGFLLQNMVALLTYDDSVKRLLFAKKLPNHDVLAGLLLTLQARIKARRPQNVK

Sequence clustering based on sequence similarity using MMseqs2