Cdis021092.1
Basic Information
- Insect
- Ceraclea dissimilis
- Gene Symbol
- -
- Assembly
- GCA_963576895.1
- Location
- OY756380.1:10183766-10184590[-]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 6 3.2 8.6e+03 -2.6 0.1 26 38 106 118 101 127 0.68 2 6 0.00012 0.31 11.6 0.0 21 44 129 152 122 160 0.88 3 6 0.26 6.7e+02 0.9 0.1 21 33 157 169 152 184 0.77 4 6 8.3e-05 0.22 12.1 0.1 21 47 185 211 179 217 0.86 5 6 0.39 1e+03 0.3 0.1 21 43 213 235 209 240 0.78 6 6 0.0013 3.4 8.2 0.0 21 43 241 263 234 271 0.86
Sequence Information
- Coding Sequence
- ATGGATGaagctagtgctagtgtacataatgaagcaGAAGAATttgtaataactgatattataactgatgaagacaccAAGGACATCTTAAAGAacgtcactgtgaaacaagaacctgctgaggagagtgaagtcgatgttggacatgctattccttatggagacattgatatacatgaactTGATGTTAAAGCAGAGTGCGAGAGAGTTAGTAGAGAAAACAATTCAACTTCAGTGGCCAGTACATCTTCCAAATGTGACAAGAGGATTGTAGTTTCCAAACGGATTCAAAAGAATGTGAAGAAGCGTAAAAATtgctgtaatatttgcatgaagacatttagtgaCGCGTCACATCTGAatatacataaacgaattcatactggcgaaaaaccttttgagtgtagtatttgcatgaagacatttaatcAGGAGATAAATTTAAAGAGACATAATCGAActcacaccggcgaaaaaccttttgagtgtaatatttgcatgaagacatttagttcGACGTCATATCTGAATATACATAAACGTATTCATACTGGCGAAAGACCTTTTGAGTgtagtatttgcatgaagacatttaatcAGGAGATAAATTTAAAGAGACATAAtcgaattcacaccggcgaaaaaccctttgagtgtagTGTTTGCACAAAGATATTTAGTACGACGTCACAATTGAATGTACATAAACGTGTTCATACCggggaaaaaccttttgagtgtaatatttgcatgaagacatttagtcagTCGTCATCTCTAAAAacacataaactaattcacactggtaAAAACCGTAGATGTTAG
- Protein Sequence
- MDEASASVHNEAEEFVITDIITDEDTKDILKNVTVKQEPAEESEVDVGHAIPYGDIDIHELDVKAECERVSRENNSTSVASTSSKCDKRIVVSKRIQKNVKKRKNCCNICMKTFSDASHLNIHKRIHTGEKPFECSICMKTFNQEINLKRHNRTHTGEKPFECNICMKTFSSTSYLNIHKRIHTGERPFECSICMKTFNQEINLKRHNRIHTGEKPFECSVCTKIFSTTSQLNVHKRVHTGEKPFECNICMKTFSQSSSLKTHKLIHTGKNRRC
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00299508;
- 90% Identity
- iTF_00299508;
- 80% Identity
- iTF_00299508;