Clyc025252.1


Basic Information
Transcription Factor Domain
Sequence Information
Similer Transcription Factors

Basic Information

Insect
Cecropterus lyciades
Gene Symbol
egl-13
Assembly
GCA_002930495.1
Location
MOOZ01044707.1:433942-446724[+]

Transcription Factor Domain

TF Family
HMG
Domain
HMG_box domain
PFAM
PF00505
TF Group
Other Alpha-Helix Group
Description
High mobility group (HMG) box domains are involved in binding DNA, and may be involved in protein-protein interactions as well. The structure of the HMG-box domain consists of three helices in an irregular array. HMG-box domains are found in one or more copies in HMG-box proteins, which form a large, diverse family involved in the regulation of DNA-dependent processes such as transcription, replication, and strand repair, all of which require the bending and unwinding of chromatin. Many of these proteins are regulators of gene expression. HMG-box proteins are found in a variety of eukaryotic organisms, and can be broadly divided into two groups, based on sequence-dependent and sequence-independent DNA recognition; the former usually contain one HMG-box motif, while the latter can contain multiple HMG-box motifs. HMG-box domains can be found in single or multiple copies in the following protein classes: HMG1 and HMG2 non-histone components of chromatin; SRY (sex determining region Y protein) involved in differential gonadogenesis; the SOX family of transcription factors [1]; sequence-specific LEF1 (lymphoid enhancer binding factor 1) and TCF-1 (T-cell factor 1) involved in regulation of organogenesis and thymocyte differentiation [2]; structure-specific recognition protein SSRP involved in transcription and replication; MTF1 mitochondrial transcription factor; nucleolar transcription factors UBF 1/2 (upstream binding factor) involved in transcription by RNA polymerase I; Abf2 yeast ARS-binding factor [3]; yeast transcription factors lxr1, Rox1, Nhp6b and Spp41; mating type proteins (MAT) involved in the sexual reproduction of fungi [4]; and the YABBY plant-specific transcription factors.
Hmmscan Out
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc
1 1 5.3e-28 4.8e-25 88.4 3.2 1 69 176 244 176 244 0.99

Sequence Information

Coding Sequence
ATGGAAAAACTTGGTCGATTACCAGTGGCGCTTCGGTCTCCGCGTATCAACATAGGCAATGTGTCGGCCGAGTTGGAGCTACAAAGACTGCAGCAGGAGCATATGCGTCGCCAGGAGATGGTGCGGCGTGGACAGCACTCCCTATACCCTGGTCCGCCACTCGCGCTGCTTCCCCTGCTGGAACAGATGAGACCACAGCCGCCTCAAGGCAATGTGGTCCAAAACCCCTGGCCAGCGACAGCTCAGCTCGCCCAGCTGACAGCCAGCGCCCGTTCCCCTCCCCCGCAGGACCCCGACGCGCCCTTAAACCTTAGCAAGCAGCGCTCCCCCTCCCCCGCGCCCTCCATCATGCTGCCCCGGTTCGTGCCCTACCCGCCCATGGAGGACAACACGCCCTATATGCAAAAGGATGACGACTACAACTCAGCTTGCAACACTTCATCCTGGGGACAGTCTCCACCAGAAGAAGCAGAGAAGGCCAAGTTAGTACGACAGCCTAAACGCGATGAGGCTGGCAAGCCTCACATCAAGAGACCAATGAACGCATTCATGGTTTGGGCTAAAGATGAGCGCAGGAAGATTCTTAAAGCATGCCCTGATATGCACAACTCGAACATCTCCAAAATCCTCGGAGCTAGATGGAAGGCCATGTCCAACGCGGAGAAACAACCCTACTACGAGGAACAGTCAAGGTTGTCAAAACTGCACATGGAAAAGCATCCTGATTACAGGTACCGGCCTCGACCGAAGCGCACTTGCATAGTCGACGGTAAGAAGATGCGGATATCGGAGTACAAGAATCTGATGCGCAGTCGCCGGCAGGAGATGAGGCAACTGTGGTGCCGGGATGGCGGCAGCGAGTTGGGCTTCTTGCCCTCGCTGTCATCCCCGGGACCTTCCAACTCCTCGCCACCACCCAATGGTGGGAACTATATGAACCCCGCGTTCTCGCCTCCACTTTCGCCGCGAGAGGAAGATTGA
Protein Sequence
MEKLGRLPVALRSPRINIGNVSAELELQRLQQEHMRRQEMVRRGQHSLYPGPPLALLPLLEQMRPQPPQGNVVQNPWPATAQLAQLTASARSPPPQDPDAPLNLSKQRSPSPAPSIMLPRFVPYPPMEDNTPYMQKDDDYNSACNTSSWGQSPPEEAEKAKLVRQPKRDEAGKPHIKRPMNAFMVWAKDERRKILKACPDMHNSNISKILGARWKAMSNAEKQPYYEEQSRLSKLHMEKHPDYRYRPRPKRTCIVDGKKMRISEYKNLMRSRRQEMRQLWCRDGGSELGFLPSLSSPGPSNSSPPPNGGNYMNPAFSPPLSPREED*

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity
iTF_01359737; iTF_00761665; iTF_00007073; iTF_01416770; iTF_01083316; iTF_01415828; iTF_00931393; iTF_00709223; iTF_00821819; iTF_00932540; iTF_00947873; iTF_00794594; iTF_01143812; iTF_00156229; iTF_00155285; iTF_00345797; iTF_00674278; iTF_00355143; iTF_00356185; iTF_00637640; iTF_01209257; iTF_01208176; iTF_00125114; iTF_00342186; iTF_01251722; iTF_00922860; iTF_01141652; iTF_01385740; iTF_01387585; iTF_01386692; iTF_01388456; iTF_01020280; iTF_00871277; iTF_00250446; iTF_00321582; iTF_00412495; iTF_00433135; iTF_01377460; iTF_00072145; iTF_01491924; iTF_00869618; iTF_01152147; iTF_01302325; iTF_00640309; iTF_00407574; iTF_00406739; iTF_00942807; iTF_00432185; iTF_01502077; iTF_00157191; iTF_00441479; iTF_00706951; iTF_01436077; iTF_00404911; iTF_01166683; iTF_01360603; iTF_00178146; iTF_00275253; iTF_00077466; iTF_01336832; iTF_00150537; iTF_01501100; iTF_00844335; iTF_01403418; iTF_01544867; iTF_01542951; iTF_01546634; iTF_01543921; iTF_00198106; iTF_01222464; iTF_00256901; iTF_00144558; iTF_00255891; iTF_00208871; iTF_00207902; iTF_00162800; iTF_00161532; iTF_00236615; iTF_01490115; iTF_00247175; iTF_00248066; iTF_00159824; iTF_01453255; iTF_01451440; iTF_01452307; iTF_01090760; iTF_01401280; iTF_01142376; iTF_00795694; iTF_00957935; iTF_01402703; iTF_01561103; iTF_00013009; iTF_00072803; iTF_00011973; iTF_00204338; iTF_01337736; iTF_01437972; iTF_01438915; iTF_00358549; iTF_00357489; iTF_00711000; iTF_00710189; iTF_00970392; iTF_00786778; iTF_00166907; iTF_00840284; iTF_01082428; iTF_00971357; iTF_00832992; iTF_00621985; iTF_00662210; iTF_00267169; iTF_00661269; iTF_00909698; iTF_00377094; iTF_01180296; iTF_01073601; iTF_01173262; iTF_01179477; iTF_01528278; iTF_01221560; iTF_00327067; iTF_01170586; iTF_00875292; iTF_00874447; iTF_00876156;
90% Identity
iTF_00642303;
80% Identity
-