Clyc017144.1
Basic Information
- Insect
- Cecropterus lyciades
- Gene Symbol
- bun_1
- Assembly
- GCA_002930495.1
- Location
- MOOZ01002041.1:607568-608168[+]
Transcription Factor Domain
- TF Family
- TSC22
- Domain
- TSC22 domain
- PFAM
- PF01166
- TF Group
- Basic Domians group
- Description
- These proteins are highly similar in a region of about 50 residues that include a conserved leucine-zipper domain most probably involved in homo- or hetero-dimerisation. Drosophila protein bunched [1] (gene bun) (also known as shortsighted), a probable transcription factor required for peripheral nervous system morphogenesis, eye development and oogenesis.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 6.1e-32 1.7e-27 95.9 0.6 2 54 35 87 35 90 0.98
Sequence Information
- Coding Sequence
- ATGATTGACGTCGTACCGCTGCAACCGAGAGATGGCTGCCTGTACGAAATCAGACAAAAGGGACAGAAAAATCCCTGTTACGTGGTCGTGCCTAATCCAGAAGATCTGGTTAAGAGCCACTTGATGTTCGCGGTGCGCGAGGAGGTGGAAGTGCTGAAGGAGCGCATCGCCGAACTCATGGAAAGGATCAACCAGCTCGAAGTGGAGAACAGCTACCTACGCGCGCACGCCAGCCAGGACACGCTGGCGCAGCTGCCGGCCGCGGGCGCGAAGCCGCCGCCGCAGCCGCAGGGCCCCCAGCCCCCCGTGTCGTAG
- Protein Sequence
- MIDVVPLQPRDGCLYEIRQKGQKNPCYVVVPNPEDLVKSHLMFAVREEVEVLKERIAELMERINQLEVENSYLRAHASQDTLAQLPAAGAKPPPQPQGPQPPVS*
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00709941;
- 90% Identity
- iTF_00770861;
- 80% Identity
- -