Basic Information

Transcription Factor Domain

TF Family: BTB
Domain: zf-C2H2|ZBTB
PFAM: PF00651
TF Group: Zinc-Coordinating Group
Description: The BTB (for BR-C, ttk and bab) [6] or POZ (for Pox virus and Zinc finger) [1] domain is present near the N-terminus of a fraction of zinc finger (Pfam:PF00096) proteins and in proteins that contain the Pfam:PF01344 motif such as Kelch and a family of pox virus proteins. The BTB/POZ domain mediates homomeric dimerisation and in some instances heteromeric dimerisation [1]. The structure of the dimerised PLZF BTB/POZ domain has been solved and consists of a tightly intertwined homodimer. The central scaffolding of the protein is made up of a cluster of alpha-helices flanked by short beta-sheets at both the top and bottom of the molecule [2]. POZ domains from several zinc finger proteins have been shown to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes including N-CoR and SMRT [5, 3, 4]. The POZ or BTB domain is also known as BR-C/Ttk or ZiN.
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 2 1.3e-22 1.3e-20 73.7 0.6 7 109 180 281 175 282 0.89

2 2 1.9 1.8e+02 2.4 0.0 77 107 281 311 279 314 0.87

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	2	1.3e-22	1.3e-20	73.7	0.6	7	109	180	281	175	282	0.89
2	2	1.9	1.8e+02	2.4	0.0	77	107	281	311	279	314	0.87

Coding Sequence: ATGATGAACCAAGTCCACGCTTTCACAAAAGTGCAAGTCATCGAGTTCAAGTACAACTGGAGCATCGAGAACTTCAGCTTTTTATCCAAAGAGCCAGGATTCATGGTGACATCGCTGCCCTTCACCATGCCCGGAACTGAGTCCAATTGGTGCTTGAAACTCTATCCCGGAGGCATAAACCCCGATTGCGAAGAGCACATCTCGGTGTTCCTCAAATTGTTGAAATCAGAGAGAGCAGATGTCATGGCAAAGTTCAAACTGTACCTcgagaaaaacaacaattcCTTCGGCGATAGTCTGGAAACTGGCATCTACAATTTCTCGCAGGAAGAGTACGGCTTTCCAAAAGTCGTCAAACGGGACGTTCTCATGCAGCAGGAAAACGGTCTACTTCTCGATGACAAACTTACGATCATCTGCGAGATCAAATTGAATGCGGGTGTGATCGCTAACAGCTTCGACAATCAATTTTCATACATCAGTGATGCGGACAAGTGTAAAGTGAAGTTTATCAACGACATTTACGATATTTATCTCAAGAGGGTGCTGAGCGACGTTACGCTAGTATTAGACTGCGGCAAGGAATGTTTCGCTCATAGAGCAATTTTAGCGGCGAGAAGCCCGATCTTCGCCGACATGTTCGTTAACAATCCGACGAAGAATGAATTCGAAATCGATGACGTTGACTTCGACGTGATGGAGGAGGTGTTGCGATATTTGTATACGGGAAAAGttcttgtaaataattttgttttggtGAAAGACTTCTTGAAAACCGCGGTTGATTATCAGTTTTACGATTACGATTTGGAAAAAGTTTGCGAGTCCTTGCTAATCACTCAAATAGATACTTCCAATGTTACAGAACTATTCATCTTTGCCGATGAGTACGATCTATACAATTTGCAGCAGGCTGCCATCAAATACATAGTCGGCCATTCTCGGGAAGTAACGAGAACGCCGGGATATAAGGACATGGTAACGTCCCATCCAGATTTAGTTTCGCAACTCTTTTGCGCACTGGCACCTCATAATAAGCTTGTTCCATAA
Protein Sequence: MMNQVHAFTKVQVIEFKYNWSIENFSFLSKEPGFMVTSLPFTMPGTESNWCLKLYPGGINPDCEEHISVFLKLLKSERADVMAKFKLYLEKNNNSFGDSLETGIYNFSQEEYGFPKVVKRDVLMQQENGLLLDDKLTIICEIKLNAGVIANSFDNQFSYISDADKCKVKFINDIYDIYLKRVLSDVTLVLDCGKECFAHRAILAARSPIFADMFVNNPTKNEFEIDDVDFDVMEEVLRYLYTGKVLVNNFVLVKDFLKTAVDYQFYDYDLEKVCESLLITQIDTSNVTELFIFADEYDLYNLQQAAIKYIVGHSREVTRTPGYKDMVTSHPDLVSQLFCALAPHNKLVP

Sequence clustering based on sequence similarity using MMseqs2