Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 4 0.00098 5.5 7.8 0.2 22 47 86 111 77 116 0.82

2 4 0.0032 18 6.2 0.1 21 43 113 135 110 141 0.91

3 4 0.0031 18 6.2 0.0 21 43 141 163 138 169 0.89

4 4 3.8e-05 0.22 12.3 0.2 21 46 169 194 165 202 0.86

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	4	0.00098	5.5	7.8	0.2	22	47	86	111	77	116	0.82
2	4	0.0032	18	6.2	0.1	21	43	113	135	110	141	0.91
3	4	0.0031	18	6.2	0.0	21	43	141	163	138	169	0.89
4	4	3.8e-05	0.22	12.3	0.2	21	46	169	194	165	202	0.86

Coding Sequence: ATGGTTGATGGTCTACAAGGattcgataataatattttagaatcattaaaatcggaATCAACGAATCAAGTTCAATGTATGGATTGTCAAAAgTACTTTAGTTCAGAGGAATTAATGATATCACATCGTTTGATTCGACATTCGTCTgtcaataatacaaataattctatggaaaaaatatatgaatgtgATGTTTGCatgaaaacatttcataagCATAGCAGTTGGTGGAAACATAAAAAGTGTCATACAGGTGAACGAGcctataaatgttatatttgtgAGAAAGCCTTTACTCAACAAGCGAATCTTCATCGGcaTATGTATGTACATTCAGGCGAGAAACctcatatttgtaaaatttgtgaTAAAAGATTTTCTCAAGCGGCTAATCTGGTTAAACATCAAGTGACGCATACAaatgaGAAGCCATTTGCTTGTAAACTTTGTTCAAAACAGTTCACACAAAGAGccaacttaaaaaaacatgAGATGGTTCACACGGGAGAACGACCACATTCATGTCCGATATGCAAAAAATCCTACGCACAATATGCCAATATGAAAAAACATATGTTGGTACatgcaaaatcaaaacaatcgGTAGCATATTTATGtgcaaaatgtaaaattttatttgataccATTACCGTTTATGATGAACACCTGGAAAGTTGTAAAAATAGTAATGTCAATTATGATTTCGATGTggttttagaaaaattggcTAATTCTAGTCGTGATAAGGATTTAGGTGAATGTTCATCATCTACAAATATTGCTGCATCTTCAATTCACCATCCatccaataataaattaataagataa
Protein Sequence: MVDGLQGFDNNILESLKSESTNQVQCMDCQKYFSSEELMISHRLIRHSSVNNTNNSMEKIYECDVCMKTFHKHSSWWKHKKCHTGERAYKCYICEKAFTQQANLHRHMYVHSGEKPHICKICDKRFSQAANLVKHQVTHTNEKPFACKLCSKQFTQRANLKKHEMVHTGERPHSCPICKKSYAQYANMKKHMLVHAKSKQSVAYLCAKCKILFDTITVYDEHLESCKNSNVNYDFDVVLEKLANSSRDKDLGECSSSTNIAASSIHHPSNNKLIR

Sequence clustering based on sequence similarity using MMseqs2