Basic Information

Transcription Factor Domain

TF Family: PC4
Domain: PC4 domain
PFAM: PF02229
TF Group: Unclassified Structure
Description: This domain is found at the C-terminal end of Activated RNA polymerase II transcriptional coactivator p15 from humans, YdbC from Lactococcus lactis, and other PC4 family members. p15 has a bipartite structure composed of an N-terminal regulatory domain and a carboxy-terminal cryptic DNA-binding domain [1-4]. Activity is controlled by protein kinases that target the regulatory domain.
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 1 2.8e-28 7.2e-24 83.5 0.9 1 51 43 93 43 94 0.96

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	1	2.8e-28	7.2e-24	83.5	0.9	1	51	43	93	43	94	0.96

Coding Sequence: ATGCCTAAAAACAAGAAGAAGGCTGAAAGTTCCAGCAGCGATAGCGACGATGGCCCTGTTGATAGGAATCCCCCTCCAGAGAAGAAAGCAAAGATGGGTTCTAGAACAGATGACAAAGAACCAACATGGGTTTTAGAAGGAAAGAAACTTGTTAAAGTTCGGGAATTTAAAGGCAAGGTCTATGTTGATGTTAGAGAATTTTATGAGAAAAATGGTGAACTATTACCAGGGAAAAAGGGTATAAGTATGACTCCAGAGCAGTGGAGGAAATTGTTATCACTAGGAGATGAAATCAATGAAACTATCAGCACAATGTgttaa
Protein Sequence: MPKNKKKAESSSSDSDDGPVDRNPPPEKKAKMGSRTDDKEPTWVLEGKKLVKVREFKGKVYVDVREFYEKNGELLPGKKGISMTPEQWRKLLSLGDEINETISTMC

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_01076532;
90% Identity: iTF_00034759; iTF_00026882; iTF_00450149; iTF_00027783; iTF_01134818; iTF_01403461; iTF_00275300; iTF_00468203; iTF_00467432; iTF_00006309; iTF_00356230; iTF_01071659; iTF_00347500; iTF_00960959; iTF_00279141; iTF_00034760; iTF_00736648; iTF_01260137; iTF_00752107; iTF_00687906; iTF_01564684; iTF_00035694; iTF_01245966; iTF_00072848; iTF_01334930; iTF_00318885; iTF_01081623; iTF_01020325; iTF_00382651; iTF_00013053; iTF_00448159; iTF_01078239; iTF_01506374; iTF_01080746; iTF_01079086; iTF_01507248; iTF_01079925; iTF_01508094;
80% Identity: iTF_00034759;