Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 0.00019 1.4 10.9 0.3 26 44 16 34 8 38 0.88

2 6 3.8e-05 0.27 13.1 0.1 21 52 39 70 34 72 0.89

3 6 0.085 6e+02 2.4 0.1 16 46 91 121 87 127 0.81

4 6 0.043 3.1e+02 3.4 0.0 21 43 124 146 120 157 0.85

5 6 0.98 7e+03 -1.0 0.1 21 38 152 169 144 178 0.73

6 6 2e-05 0.14 14.0 0.1 21 45 180 204 174 209 0.91

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	0.00019	1.4	10.9	0.3	26	44	16	34	8	38	0.88
2	6	3.8e-05	0.27	13.1	0.1	21	52	39	70	34	72	0.89
3	6	0.085	6e+02	2.4	0.1	16	46	91	121	87	127	0.81
4	6	0.043	3.1e+02	3.4	0.0	21	43	124	146	120	157	0.85
5	6	0.98	7e+03	-1.0	0.1	21	38	152	169	144	178	0.73
6	6	2e-05	0.14	14.0	0.1	21	45	180	204	174	209	0.91

Coding Sequence: atGCGTGCCCATCAAAAAGTACATACAGGTGATCAGCGATCATATGAATGTCAAATTTGTTATAGGGTATTTAATCATGGTAGTAATTTGCGTGTCCATATGCGTACACATACTGGCGAACAACCATATAAATGCGATAAATGTTCTAAAGCATTCAGTAAATCGGATACTTTACGTAGACATTTAATGATACATAATGGGCAAAAACCGTATGCATGTAAACTTTGTAACGAAGAATTTAATTCCACCATAAAATTATATGAACATGTGCGAATTCATACCGGGAAGGAATCGCCGTATAAATGCGAATTTTGTAGTAAAGTATTAGCTTCGGTCAGTAGTTTAAAAGTACATAAACGGTTACATACCGGTGAGCGGCCATTCAAATGTGAAATATGTTCTAAAATGTTTACTACCAAAAGTGATTTAAAGAAACATAAATTAATACACTCTGATGAACGCCCTTTCGCTTGTAGGTATTGCAATAAAGCATTTAGTCGGTCTAGTGTATTACTTTGTCATGAGCGCGTCCATACCGGTGAACAACCATACTTGTGTGACATCTGCAGTAAAACATTCAGTCAGTCTGGTCATTTACGTACTCACTTAAGGAAGCACCAACGAGGTTCGCATGAGCCTATCAAATGA
Protein Sequence: MRAHQKVHTGDQRSYECQICYRVFNHGSNLRVHMRTHTGEQPYKCDKCSKAFSKSDTLRRHLMIHNGQKPYACKLCNEEFNSTIKLYEHVRIHTGKESPYKCEFCSKVLASVSSLKVHKRLHTGERPFKCEICSKMFTTKSDLKKHKLIHSDERPFACRYCNKAFSRSSVLLCHERVHTGEQPYLCDICSKTFSQSGHLRTHLRKHQRGSHEPIK

Sequence clustering based on sequence similarity using MMseqs2