Basic Information

Transcription Factor Domain

TF Family: BTB
Domain: zf-C2H2|ZBTB
PFAM: PF00651
TF Group: Zinc-Coordinating Group
Description: The BTB (for BR-C, ttk and bab) [6] or POZ (for Pox virus and Zinc finger) [1] domain is present near the N-terminus of a fraction of zinc finger (Pfam:PF00096) proteins and in proteins that contain the Pfam:PF01344 motif such as Kelch and a family of pox virus proteins. The BTB/POZ domain mediates homomeric dimerisation and in some instances heteromeric dimerisation [1]. The structure of the dimerised PLZF BTB/POZ domain has been solved and consists of a tightly intertwined homodimer. The central scaffolding of the protein is made up of a cluster of alpha-helices flanked by short beta-sheets at both the top and bottom of the molecule [2]. POZ domains from several zinc finger proteins have been shown to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes including N-CoR and SMRT [5, 3, 4]. The POZ or BTB domain is also known as BR-C/Ttk or ZiN.
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 3 3.4 2.7e+03 0.3 0.1 77 108 103 135 99 137 0.72

2 3 1.9e-21 1.5e-18 68.7 0.1 10 108 188 286 180 288 0.91

3 3 0.23 1.9e+02 4.1 0.1 77 109 287 319 281 320 0.86

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	3	3.4	2.7e+03	0.3	0.1	77	108	103	135	99	137	0.72
2	3	1.9e-21	1.5e-18	68.7	0.1	10	108	188	286	180	288	0.91
3	3	0.23	1.9e+02	4.1	0.1	77	109	287	319	281	320	0.86

Coding Sequence: atgtacGAAACAAGTGAAGAAGCCGGCGTTGCACAGAACAGAATCAAAATTATGGACTCTGAGGTAGTGTTTGGACATCGGATGGTACAGACTCGTGATGTTAAATGGCTATGTCTTGAGCACATATACCAGAAGTTATACCGTCCCAACTTTTACGATGTTGGTGGTACTCATATGCAGGATGTGCCAGATTACTGGTTTACGTACAAAACGGAACAAGTTGGGAACTTATTTCTCCTACACCTATTCATCTGTAACCACGGCGTGAGTTCATTTAACGTCGCCGTGAGCTGCGGAAATAAACTAAAAGTCGATAAAAAGAACAACATTGTATACTTACAACAGTATCTCAAAGAATTCCAATTCAAAAAGCTTACAGAAATGTCTCACAGCTATCTCACTACCTACAACTTTACAGAGCTTGATGTAGAGGTTTTGAAAGACAGGAACCTGTATATTTCTGTATCATTACCATTTGATAAGAAGGAAGGCATTAGCCttgatgttataaataatatcaaaatcaacCATGATTGTAGTGCTCTCTTGTCAGATCCTATTGGCTCAGATTTCACTATAGAATCTGCAGATGGGGCAAAATTCCAGATACACAAAGTTATACTGGCAGCACACAGCGAAGTGTTCAAAGCAATGCTCAAAGAAGAAACTGCTGAGAGTCAGAACAGTTATGTAAAACTTGTTGATGTTTGTGAAGAAGATCTGCGTTGTATGTTGGAATACATCTACACAGGGACAGTTAAAGATGTTGAGAACGTAAATTTCGGCAGTCTCCTCATGCTAGCTGATCGATACAACTTACGAGGACTTTGGGAATTGTCTCAGTATGCTTTATCAGAACAGATTAGCTTAGATAATGCTCTCGACATCCTTGTTATTGCTGATATGTATGATTCGGACTTCTTGAAAATGGAAGCTTTgaaatttataaagaataatatagaGGTGCTTCAAAGTAGTACTTTCAAAGAGATTAATAATGCTGATCTAGTCAGGCAGTTGTGTACTTACTTGGCTTCATAA
Protein Sequence: MYETSEEAGVAQNRIKIMDSEVVFGHRMVQTRDVKWLCLEHIYQKLYRPNFYDVGGTHMQDVPDYWFTYKTEQVGNLFLLHLFICNHGVSSFNVAVSCGNKLKVDKKNNIVYLQQYLKEFQFKKLTEMSHSYLTTYNFTELDVEVLKDRNLYISVSLPFDKKEGISLDVINNIKINHDCSALLSDPIGSDFTIESADGAKFQIHKVILAAHSEVFKAMLKEETAESQNSYVKLVDVCEEDLRCMLEYIYTGTVKDVENVNFGSLLMLADRYNLRGLWELSQYALSEQISLDNALDILVIADMYDSDFLKMEALKFIKNNIEVLQSSTFKEINNADLVRQLCTYLAS

Sequence clustering based on sequence similarity using MMseqs2