Cbif015101.1
Basic Information
- Insect
- Cartodere bifasciata
- Gene Symbol
- -
- Assembly
- GCA_963920755.1
- Location
- OY987199.1:10246043-10247155[+]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 5 3.8e-07 0.0076 16.5 0.2 12 49 7 44 3 48 0.91 2 5 0.015 3e+02 1.8 0.1 26 48 98 120 84 123 0.82 3 5 6.7e-07 0.013 15.7 0.2 12 48 134 170 130 175 0.91 4 5 0.0019 38 4.7 0.1 25 48 224 247 211 250 0.81 5 5 0.29 5.9e+03 -2.3 0.0 27 44 272 289 267 294 0.68
Sequence Information
- Coding Sequence
- ATGATTCCAAAAACGACAAcagtaaaaacaaaatggcGCCCACAACAAGAAAACGATTTTGAATGTAAACAGTGTAAAATAAAGTACAAATATAAAAGAAACCTGCGTAGACACGTCAAAAAAAGACATGGTAACTTACCAGTAGCTGAAATGATTCCAAAAACGACAACAGTAAAGACAAAATGGCGCCcaagtgttttaaaaaaccacgTCGGTAAAACCGCATACAAATCTACCAAAATTGACTCCGAAAGAAAAGTGGGCATAACACAACAAGAAAAGGGACATTTTGAATGTAAACAGTGCAAAATAAAGTACAAATATAAAAGAGGTCTACAAAGACACGTCAAAATAAATCATGGCAACTTAGCACTAGTTGAAATGCTTCCAAAAACGACAAcagtaaaaacaaaatggcGCCCACAACAAGAAAACGATATTGAATGTAAACAGTGTAAAATAAAGTACAAATATAAAAGAAACCTACGTAgacacatcaaaacaaaacatggTAACTTACCACTAGCTGAAATGATTCCAAAAACGACAACAGTAAGGACAAGATGGCGTCcaagtgttttaaaaaaccacgCTGGTAAAACCGTGTACAAATCTACCAAAATTGACGCCAAAAGAGAAGTGAGCATAACACAACAAGAAAACGATCATTTTGAATGTAAACAGTGTCAAATAAAGTACAAATATAAAAGAGGCCTTCGTGAACACCtcaaaataaaacatggtaACTTAGAATTGTTCCCAAAAACGGAAACAGTAAAGAAAAAATGGCGCCCAACTGTTAAAACACACGAATGCTACTTTTGCCTTAAGAAATTCAACAATAAAAAGGATCTAACGCGTCATTTTTTAGCAACCCATACCGATTTCAAGGTCTTTAAATGTCAGTTATGCCCCCTAGCTTACAAATACAAGCACGGGCTAAGTCGTCACTgccaaaaatttcatgaaatacCTCCTCAAACATATGAGCTCCTAATTACGACACCTGAAATATCATGCGAAATTTGTAACATGAAATGTTCCAACGAAACTGAGTTACAGCTTCACGCTATTTTTTACGAGCATGCAGATTGCAATAATAATTCAGTTTAA
- Protein Sequence
- MIPKTTTVKTKWRPQQENDFECKQCKIKYKYKRNLRRHVKKRHGNLPVAEMIPKTTTVKTKWRPSVLKNHVGKTAYKSTKIDSERKVGITQQEKGHFECKQCKIKYKYKRGLQRHVKINHGNLALVEMLPKTTTVKTKWRPQQENDIECKQCKIKYKYKRNLRRHIKTKHGNLPLAEMIPKTTTVRTRWRPSVLKNHAGKTVYKSTKIDAKREVSITQQENDHFECKQCQIKYKYKRGLREHLKIKHGNLELFPKTETVKKKWRPTVKTHECYFCLKKFNNKKDLTRHFLATHTDFKVFKCQLCPLAYKYKHGLSRHCQKFHEIPPQTYELLITTPEISCEICNMKCSNETELQLHAIFYEHADCNNNSV
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00278625;
- 90% Identity
- iTF_00278625;
- 80% Identity
- iTF_00278625;