Basic Information

Transcription Factor Domain

TF Family: HMGA
Domain: HMGA domain
PFAM: AnimalTFDB
TF Group: Unclassified Structure
Description: This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.0023 64 4.0 1.8 11 16 13 18 10 19 0.83

2 5 0.015 4.2e+02 1.3 0.4 12 15 33 36 32 43 0.77

3 5 8e-10 2.2e-05 24.6 2.3 6 21 54 69 50 70 0.85

4 5 0.27 7.6e+03 -2.7 0.4 7 9 72 74 71 75 0.50

5 5 1 2.8e+04 -5.0 4.3 10 14 83 87 82 89 0.54

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.0023	64	4.0	1.8	11	16	13	18	10	19	0.83
2	5	0.015	4.2e+02	1.3	0.4	12	15	33	36	32	43	0.77
3	5	8e-10	2.2e-05	24.6	2.3	6	21	54	69	50	70	0.85
4	5	0.27	7.6e+03	-2.7	0.4	7	9	72	74	71	75	0.50
5	5	1	2.8e+04	-5.0	4.3	10	14	83	87	82	89	0.54

Coding Sequence: ATGTCTGATGATGGATCACCTATTGTTGAAAAGAAAGGACGTGGAAGACCTAAAGCCAACGGGGCTCCTGTAGATACTAAAGCAGATACTAAGAAACGAGGAAGACCACCAGCAGCTAAAACTAAAGAATCAAAAACCTCATCTGATGATGAGCAGGCACCAGTTGTGAAAAGAGGAAGAGGTAGGCCTAAGGGATCAAAGAAGAAGGCACCTGCCCCTAAAGGAAAGGTTGGTTCTGGAGAGGGGCGAGGTCGTGGCAAGCCACGTAAAGAAGCAGCTGCTCCAGCCAAGAAAGATGCTGGTTCTACAGAAGAGGAGCAAGATGATGAGGATGATGATGAAGGCTCTGACCAGTAA
Protein Sequence: MSDDGSPIVEKKGRGRPKANGAPVDTKADTKKRGRPPAAKTKESKTSSDDEQAPVVKRGRGRPKGSKKKAPAPKGKVGSGEGRGRGKPRKEAAAPAKKDAGSTEEEQDDEDDDEGSDQ

Sequence clustering based on sequence similarity using MMseqs2