Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 3 0.0023 5 8.2 0.1 23 45 91 113 83 116 0.90

2 3 0.0013 2.9 8.9 0.0 21 45 117 141 113 144 0.85

3 3 1.5e-05 0.032 15.2 0.3 20 43 144 167 142 174 0.92

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	3	0.0023	5	8.2	0.1	23	45	91	113	83	116	0.90
2	3	0.0013	2.9	8.9	0.0	21	45	117	141	113	144	0.85
3	3	1.5e-05	0.032	15.2	0.3	20	43	144	167	142	174	0.92

Coding Sequence: atgGAAACTTCTTTGGATAGCTACTCCCCAATTAAGCCAGAACTAATCGAGTTCAAGGTGGAAGATCTGCCACAGGAAGAAACTACCTACTCTAAAATTAAGACAGAAGTAATCGATGTCAAGTTGGACGGTTTGCACCATACCGTTGACATCAAAGAAGATACTGCAATTCCAGATGATCAACCGGATCAAGAATGCAAACAAAAAATAGACAGGAAAGCATTATTcacatATATGTTAACAAGACACTTAAGGGCTCATACCGGTGTGAAACCTTACACGTGTGAAGTTTGCAATCAAAAATATGCAGAAAAAAGAGGTCTGAAGAGACATTTAAGAACTCACACTGGTGAGAAGCCCTTTACGTGTAaaatttgcgaatataaatttGCATACCAAGAAGAATTGAAAAGGCATTTGAAAGCCCATACCAGCGAGAAGCCTTACATGTGcgaaatttgtgactataaatgtaaAGACGAAAGAAATTTAAGAAGGCACGATACTCCGTGCCATTCAAATAGCTACCCACAAGTTAAGACGGAGGTAATGGAGTTCAAGTTAGAAGATTTACATCATTCGATTGACATTAAAGAGGAAACTACAATTCTAGATGGTAAAACGGAGGAGTTTTGTAACGGGCCAAACCGACCTTACGACGTGAAAAGGTCTAATCAAGTAATGAGGGGTCTCAGTTGTCTGGAAGGCCGCCAGCTCAAAGTCGGCAAGGTCGTGGATCGCTTAAAAAATCAGGGACATCCAGAAACCGAGTTCCACAAAACCTAA
Protein Sequence: METSLDSYSPIKPELIEFKVEDLPQEETTYSKIKTEVIDVKLDGLHHTVDIKEDTAIPDDQPDQECKQKIDRKALFTYMLTRHLRAHTGVKPYTCEVCNQKYAEKRGLKRHLRTHTGEKPFTCKICEYKFAYQEELKRHLKAHTSEKPYMCEICDYKCKDERNLRRHDTPCHSNSYPQVKTEVMEFKLEDLHHSIDIKEETTILDGKTEEFCNGPNRPYDVKRSNQVMRGLSCLEGRQLKVGKVVDRLKNQGHPETEFHKT

Sequence clustering based on sequence similarity using MMseqs2