Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 9 1.4 1.9e+03 -0.2 0.2 26 44 36 54 18 58 0.77

2 9 0.028 39 5.2 1.1 20 46 58 84 48 92 0.75

3 9 0.33 4.6e+02 1.8 0.1 18 46 84 112 82 120 0.78

4 9 1.2 1.6e+03 0.0 0.1 22 46 116 140 111 142 0.84

5 9 0.013 18 6.3 0.0 21 49 143 171 126 174 0.87

6 9 0.0084 12 6.9 0.2 21 47 171 197 167 203 0.85

7 9 0.27 3.8e+02 2.1 0.1 21 51 199 229 196 231 0.83

8 9 7.8e-05 0.11 13.4 0.2 21 48 227 254 223 258 0.87

9 9 0.00049 0.7 10.8 0.0 21 46 255 280 251 286 0.90

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	9	1.4	1.9e+03	-0.2	0.2	26	44	36	54	18	58	0.77
2	9	0.028	39	5.2	1.1	20	46	58	84	48	92	0.75
3	9	0.33	4.6e+02	1.8	0.1	18	46	84	112	82	120	0.78
4	9	1.2	1.6e+03	0.0	0.1	22	46	116	140	111	142	0.84
5	9	0.013	18	6.3	0.0	21	49	143	171	126	174	0.87
6	9	0.0084	12	6.9	0.2	21	47	171	197	167	203	0.85
7	9	0.27	3.8e+02	2.1	0.1	21	51	199	229	196	231	0.83
8	9	7.8e-05	0.11	13.4	0.2	21	48	227	254	223	258	0.87
9	9	0.00049	0.7	10.8	0.0	21	46	255	280	251	286	0.90

Coding Sequence: ATGTTGAAAGCAGAAACGGTGGAAGACGAAACACAGAATGTTGAAGAGAAAACTTCAGAAGAAACCGTCGGTGAAAGAAACGCAACAGGACCAACGGATACCATTTGTTGTGAAGTCTGCGATATGCATTTTTCCTCCAAAGCCACTTTACGACGACATTCCAGAATGCATACAGGTGAAAAACCGCATTGCTGTGAAATCTgccatcaaaaattttcactaaaagaaaaactgcGAATCCACATGAGAAGACATACGGGCGAAAAACCATTCGTATGTGAAGTTTGCGACtctgaattttcattaaaatcaattttaaaacatcacTTAAAAACGCACACTCGTGAAAAACCATTTTGTTGTGAAACTTGCGGTAAGAAATTTTCGCACAACGGAAGTTTACGAAATCATATGAAAATCCATACTAGTGAAAAGCTATTTGAGTGCGaaatttgtaacttgaaaGTTAAGCGAAGTGGGGACTTGAAAATTCACTTAAGAATTCACACGGGGGAAAAACCGTATGCATGTAAGATTTGTCACTTGAAATTTTCGCAACAAGGAAGTGTGGTACGCCATTTAAGAACTCACACCGGGGAAAAACCACACAAGTGCACGCATTGTGATTATACAACTTCCGATAGAGCACATTTGCGAACTCACTTGAGAATCCAtaccggggaaaaaccgttcgtgtgtgaaatttgcaatgcaaaattttcGCTCAGTCCAAATTTACGTTGTCACTTAAGAGTGCATACTGGCGAAAAACCATTCCAGTGTGGAGTGtgcgatttaaaatttacacaaaatagGAGTTTACAGAAGCATTTAGAAGCTCAcgagaagaaaaaaaaagctgCTGAAGTgtga
Protein Sequence: MLKAETVEDETQNVEEKTSEETVGERNATGPTDTICCEVCDMHFSSKATLRRHSRMHTGEKPHCCEICHQKFSLKEKLRIHMRRHTGEKPFVCEVCDSEFSLKSILKHHLKTHTREKPFCCETCGKKFSHNGSLRNHMKIHTSEKLFECEICNLKVKRSGDLKIHLRIHTGEKPYACKICHLKFSQQGSVVRHLRTHTGEKPHKCTHCDYTTSDRAHLRTHLRIHTGEKPFVCEICNAKFSLSPNLRCHLRVHTGEKPFQCGVCDLKFTQNRSLQKHLEAHEKKKKAAEV

Sequence clustering based on sequence similarity using MMseqs2