Cspl116032.1
Basic Information
- Insect
- Calopteryx splendens
- Gene Symbol
- -
- Assembly
- GCA_002093875.1
- Location
- LYUA01006961.1:17967-19018[+]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 5 0.71 2.1e+04 -1.7 0.0 22 31 15 24 3 37 0.72 2 5 0.0011 34 7.3 0.0 21 45 94 118 82 121 0.84 3 5 0.00013 4 10.3 0.0 21 45 122 146 118 155 0.90 4 5 0.032 9.6e+02 2.7 0.0 25 47 154 176 148 183 0.82 5 5 0.00058 17 8.2 0.0 23 45 232 254 228 257 0.90
Sequence Information
- Coding Sequence
- ATGAGGGGAAACCTGAAGGATCACATCAGGACGCACTCCGGAGACAAGCCCTACATCTGCGGGGTATGCTCTAAGGCATTCGCCCTGAAGGGCTACCTCGCCACCCACATGGCGGTGCACACTGGAGACAGGCCGCACAAGTGCTCCGCGTTCGCCCTGAAGGGCAACCTCGCCTCCCACATAGGGGTGCACACTGGATACAAGACGCACAAGTGCTCAGTGTGCTCCATGGGCTTCAGCACTAGCAGCAAGCTCAAAGATCACTCCAAAACGCACACCGGAGACAAGCCCCACATCTGTGAGGTGTGCTCCAAGGCGTTCCGAAAAAGTCATTCGCTAAAGATACACATGGCCGTGCACACCGGAGAGAGGCCACACAAGTGTCCCGTGTGTTCCATGGCTTTCAGCCTAAGCGGAAACCTTAAGAGTCACATGACCGTGCACACTGGAGAATTGGCGCATAAGTGCGCTGTGTGCTCCAAGGGCTTTAGGACGAGGAGCAACCTGAAGGATCACATCAAGACGCACTCCGGAGACAAGCCCTACAACTGCGGGGTGTGCTCTAAGACATTCGCCATGAAGGGCTACCTCGCTTCCCACATGGCGATGCACACTGGAGACAGGCCGCACAAGTGCTCCGCGTTCGCCCTGAAGGGCAACCTCGCCTCCCACATGGCGATCCACACTGGATACAAGCCTCACAAGTGCGGGGTGTGCTCCAAGGCGTTCACCCGGAGTCTCAACCTAAAGAGGCATATGGCCGTTCACTCCTGA
- Protein Sequence
- MRGNLKDHIRTHSGDKPYICGVCSKAFALKGYLATHMAVHTGDRPHKCSAFALKGNLASHIGVHTGYKTHKCSVCSMGFSTSSKLKDHSKTHTGDKPHICEVCSKAFRKSHSLKIHMAVHTGERPHKCPVCSMAFSLSGNLKSHMTVHTGELAHKCAVCSKGFRTRSNLKDHIKTHSGDKPYNCGVCSKTFAMKGYLASHMAMHTGDRPHKCSAFALKGNLASHMAIHTGYKPHKCGVCSKAFTRSLNLKRHMAVHS*
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00261379;
- 90% Identity
- iTF_00261379;
- 80% Identity
- iTF_00261379;