Bcop006292.1
Basic Information
- Insect
- Bradysia coprophila
- Gene Symbol
- Aef1
- Assembly
- GCA_014529535.1
- Location
- NW:1996300-1999858[-]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 4 0.0028 5 7.2 0.1 22 48 17 43 8 47 0.84 2 4 0.004 7.2 6.7 0.0 21 47 44 70 42 75 0.85 3 4 0.019 34 4.5 0.2 21 47 72 98 69 103 0.84 4 4 0.00015 0.26 11.3 0.1 21 51 100 130 92 133 0.87
Sequence Information
- Coding Sequence
- ATGTCGACACAAATATCTCCCAAAAAGATGACGATCACCAATGACCAACAGAAACCGTTTCAATGCGCCATCTGCGAGAAAACATTTCGTCAATTAAGCACGCTAACAAATCACTTTAAAATCCACACAGGAGAaaagCCATTCAAATGCTCAACATGCGACAAAAAATTCCGTCAGTCCAGCACTCTAACAAACCATTCAAAAATACATACGGGAGAGAAGCCTTTTTGCTGCAATTTTTGCCATAAACCGTTTCGACAGCTCAGCACACTAACTAATCACCAAAAGATTCACACCGGCGAAAAGCCGTTCGAGTGTGCCGTGTGTAAAAAGCAATTCCGTCAGTCGAGTACGCTAAACAATCACATAAAAATCCATGTGGGCGACAAGCCGTTTATGCAAGAAATGCAAGAACTGCAAAATTTGCACAATCAACAGCAGCAAGGCGATCATATCCTGGTAATGAGTGGTCATTTGGACGCATTAAAAACGGAAGCCGATTTGATTGTCGATAATGTTGATCAACAGGCACAGCATATTGTGGTGCAAATGGAACATTCGAAAGCGGAACCAGTAAAATCGGAAGCGAGTACATGA
- Protein Sequence
- MSTQISPKKMTITNDQQKPFQCAICEKTFRQLSTLTNHFKIHTGEKPFKCSTCDKKFRQSSTLTNHSKIHTGEKPFCCNFCHKPFRQLSTLTNHQKIHTGEKPFECAVCKKQFRQSSTLNNHIKIHVGDKPFMQEMQELQNLHNQQQQGDHILVMSGHLDALKTEADLIVDNVDQQAQHIVVQMEHSKAEPVKSEAST
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01266332;
- 90% Identity
- iTF_00245831; iTF_01266332;
- 80% Identity
- iTF_00245831;