Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 3 4.1e-05 0.2 12.7 0.2 19 47 36 63 27 71 0.76

2 3 0.11 5.5e+02 1.7 0.0 23 44 68 89 65 93 0.89

3 3 3.1e-05 0.15 13.1 0.3 21 43 94 116 90 123 0.89

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	3	4.1e-05	0.2	12.7	0.2	19	47	36	63	27	71	0.76
2	3	0.11	5.5e+02	1.7	0.0	23	44	68	89	65	93	0.89
3	3	3.1e-05	0.15	13.1	0.3	21	43	94	116	90	123	0.89

Coding Sequence: ATGAAGGCTCATATGTTGGATCATTTAGGACTAAAACCGTTCAAATGTTCCCAGTGCGGCAAAGGCTTCACCTCAACCACCTTGGTGAAAAAACACGAGAGGACCCATTCGAGTGAAAGGCCCTTCGAGTGTCCCATGTGCGACATGAAATTCACGAGAAACGATGTCTTGAGGAGGCACAAAATGAAGCATACCGGCGTCAAACCGTACGTGTGCAATTTCTGCGGAAAAGGGTTCGCCCAAAGTGGGGAACTTACTTCGCATCTCAGGGGACATACAGatGAGAAGCCATACGTGTGTGATCTTTGCAACGTGTCATTCCGCCAACGTCGATCTCTAAGAGAacataaactaaaaattcataatattgAAATTCCATTAAGAGAAAAACTAAAgctatttaaactttaa
Protein Sequence: MKAHMLDHLGLKPFKCSQCGKGFTSTTLVKKHERTHSSERPFECPMCDMKFTRNDVLRRHKMKHTGVKPYVCNFCGKGFAQSGELTSHLRGHTDEKPYVCDLCNVSFRQRRSLREHKLKIHNIEIPLREKLKLFKL

Sequence clustering based on sequence similarity using MMseqs2