Bmor001429.1


Basic Information
Transcription Factor Domain
Sequence Information
Similer Transcription Factors

Basic Information

Insect
Bombyx mori
Gene Symbol
bs
Assembly
GCA_027497135.1
Location
CP114946.1:2111775-2112613[-]

Transcription Factor Domain

TF Family
SRF
Domain
SRF domain
PFAM
PF00319
TF Group
Helix-turn-helix
Description
Serum response factor (SRF) is a ubiquitous nuclear protein important for cell proliferation and differentiation. SRF function is essential for transcriptional regulation of numerous growth-factor-inducible genes, such as c-fos oncogene and muscle-specific actin genes. A core domain of around 90 amino acids is sufficient for the activities of DNA-binding, dimerisation and interaction with accessory factors. Within the core is a DNA-binding region, designated the MADS box [2], that is highly similar to many eukaryotic regulatory proteins: among these are MCM1, the regulator of cell type-specific genes in fission yeast; DSRF, a Drosophila trachea development factor; the MEF2 family of myocyte-specific enhancer factors; and the Agamous and Deficiens families of plant homeotic proteins. In SRF, the MADS box has been shown to be involved in DNA-binding and dimerisation [1]. Proteins belonging to the MADS family function as dimers, the primary DNA-binding element of which is an anti-parallel coiled coil of two amphipathic α-helices, one from each subunit. The DNA wraps around the coiled coil allowing the basic N-termini of the helices to fit into the DNA major groove. The chain extending from the helix N-termini reaches over the DNA backbone and penetrates into the minor groove. A 4-stranded, anti-parallel β-sheet packs against the coiled-coil face opposite the DNA and is the central element of the dimerisation interface. The MADS-box domain is commonly found associated with K-box region see (IPR002487).
Hmmscan Out
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc
1 1 4.9e-11 2.2e-07 30.2 0.0 23 48 21 46 19 46 0.98

Sequence Information

Coding Sequence
ATGTCGCTCCCGAAACCTATGCGTATCGAGGTTTACATACGAATTAGCGGCGTGGGAGAGGCATACGAGCTATCCACTTTGACGGGGACACAAGTGATGTTGCTGGTCGCGTCGGAGACCGGCCACGTGTATACGTTCGCGACGCGGAAACTTCAGCCCATGATCACGTCCGATTCTGGGAAAAGGCTGATCCAGACGTGCCTTAACTCACCAGACCCGCCCACGACCAGCGAACAGCGCATGGCGGCTACTGGCTTCGAGGAGACCGAGCTCACGTATAACGTTGTAGACGAGGATATGAAGGTGAGGCAATTGGCATACGCGGGCACCGCGCAGTACCCTATAGAGCACCATCCAGGGCTGGCCCCGTCGCCGCTGCAGCAGTACCATCAGCACCCACCCTGTCCGTCACCGCTGCCCCTCAGCTCGCTGGGGCAGCCCTATTCTCACGCTCATCTATCTCACCCCCACATGTCGCATCATCCTCAGCGGTAG
Protein Sequence
MSLPKPMRIEVYIRISGVGEAYELSTLTGTQVMLLVASETGHVYTFATRKLQPMITSDSGKRLIQTCLNSPDPPTTSEQRMAATGFEETELTYNVVDEDMKVRQLAYAGTAQYPIEHHPGLAPSPLQQYHQHPPCPSPLPLSSLGQPYSHAHLSHPHMSHHPQR

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity
iTF_00038753; iTF_01439916; iTF_00323489; iTF_00247166; iTF_00461537; iTF_00957926; iTF_01034566; iTF_00676679; iTF_00420520; iTF_00960141; iTF_01377453; iTF_00818320; iTF_01033712; iTF_00418964; iTF_00896788; iTF_00959381; iTF_00419734; iTF_00859447; iTF_01401272; iTF_00248058; iTF_00421338; iTF_00842651; iTF_00700100; iTF_00682407; iTF_00801826; iTF_01091909; iTF_01281317; iTF_00144550; iTF_00780998; iTF_01331558; iTF_00159816; iTF_00358539; iTF_01017707; iTF_01181867; iTF_01502955; iTF_00781804; iTF_01333804; iTF_00796493; iTF_00213423; iTF_00383632; iTF_01020272; iTF_00710993; iTF_00425364; iTF_01071605; iTF_01503861; iTF_01080694; iTF_00124248; iTF_00621209; iTF_00642297; iTF_00212442; iTF_00111643; iTF_00681627; iTF_00836539; iTF_00467388; iTF_01079037; iTF_01334878; iTF_00076511; iTF_00776703; iTF_01193567; iTF_00075520; iTF_01081568; iTF_01561984; iTF_01230564; iTF_00744614; iTF_01279234; iTF_00933733; iTF_00403788; iTF_01178542; iTF_00288847; iTF_00687855; iTF_01248111; iTF_00934741; iTF_00164344; iTF_00405884; iTF_01217472; iTF_01021207; iTF_00205099; iTF_00122377; iTF_00406731; iTF_00407564; iTF_01415820; iTF_01441071; iTF_00667471; iTF_01443823; iTF_00279090; iTF_00327059; iTF_01360595; iTF_00875285; iTF_00874440; iTF_00876148; iTF_01342197; iTF_00049884; iTF_00035638; iTF_00074490; iTF_01280272; iTF_00994330; iTF_00947868; iTF_00357480;
90% Identity
iTF_00723937; iTF_01317270; iTF_01312202; iTF_01316331; iTF_00112474; iTF_01358849; iTF_00428101; iTF_00819145; iTF_00406731; iTF_00407564; iTF_01415820; iTF_00787631; iTF_01221552; iTF_00341298; iTF_01342197; iTF_00467388; iTF_00256894; iTF_00255884;
80% Identity
-