Basic Information

Transcription Factor Domain

TF Family: BTB
Domain: zf-C2H2|ZBTB
PFAM: PF00651
TF Group: Zinc-Coordinating Group
Description: The BTB (for BR-C, ttk and bab) [6] or POZ (for Pox virus and Zinc finger) [1] domain is present near the N-terminus of a fraction of zinc finger (Pfam:PF00096) proteins and in proteins that contain the Pfam:PF01344 motif such as Kelch and a family of pox virus proteins. The BTB/POZ domain mediates homomeric dimerisation and in some instances heteromeric dimerisation [1]. The structure of the dimerised PLZF BTB/POZ domain has been solved and consists of a tightly intertwined homodimer. The central scaffolding of the protein is made up of a cluster of alpha-helices flanked by short beta-sheets at both the top and bottom of the molecule [2]. POZ domains from several zinc finger proteins have been shown to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes including N-CoR and SMRT [5, 3, 4]. The POZ or BTB domain is also known as BR-C/Ttk or ZiN.
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 3 1.6e-25 2.2e-23 82.7 0.1 1 108 24 130 24 132 0.95

2 3 3 4e+02 1.4 0.2 59 80 132 155 129 169 0.60

3 3 2.6 3.5e+02 1.6 0.1 19 44 164 189 151 208 0.78

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	3	1.6e-25	2.2e-23	82.7	0.1	1	108	24	130	24	132	0.95
2	3	3	4e+02	1.4	0.2	59	80	132	155	129	169	0.60
3	3	2.6	3.5e+02	1.6	0.1	19	44	164	189	151	208	0.78

Coding Sequence: ATGACGTGTCCCAGTGGAGAAAAAAAAACTTACAAAAATGAAGAAATCATGAAAAATATATCCGAAAAACTTAACGAACAACGTAAAAAAGGAAAATACTGTGATTATGTGTTAGAAAGTGAAGATGGTGGATCATTTACAGTTCATAAAGGTGTTTTAGAATCAGTTAGTCCATTTTTTGAAAAAATACTCAATTCAGAAATAATTGGTGAGAATAAAATTTCACTTTTAATAAAAAATTGTTCATCAACTGTTTTAGAAAATATTATTGAATTTATGTACACCGGAAAAATTGAAATAATAACGGAATTTGTAAAAGAAACTCTTGATATTGCACTTTTTCTACTTTTAAATAATTTAATTGATGCATGTACAGAAAATCTAGTAGAAATGGTGAATACTGAAAATTGTTACGAACTTCTTTCATATTCTTATACTTACCATTGTGGACAAGATTTATCAAAAAAATGCATCGAAACAATTTGTAAAAATTTACACACTTTTAAGGATTCAAAAGAAATTTTAAATTTATCATCACAATCAATGGAAATGTTGCTTTCATCTACGCAAACCGTCTCAAGAGGATATAAAGAAGAGGATCTTTATTCGGTAGTTATTAAATGGTTGATACATGATTCAAAAAATCGTAATCAATTTGCTTTGGATTTTATTGATAAATTAAATTTCATAAAATAA
Protein Sequence: MTCPSGEKKTYKNEEIMKNISEKLNEQRKKGKYCDYVLESEDGGSFTVHKGVLESVSPFFEKILNSEIIGENKISLLIKNCSSTVLENIIEFMYTGKIEIITEFVKETLDIALFLLLNNLIDACTENLVEMVNTENCYELLSYSYTYHCGQDLSKKCIETICKNLHTFKDSKEILNLSSQSMEMLLSSTQTVSRGYKEEDLYSVVIKWLIHDSKNRNQFALDFIDKLNFIK

Sequence clustering based on sequence similarity using MMseqs2