Bpol002536.1
Basic Information
- Insect
- Bombus polaris
- Gene Symbol
- -
- Assembly
- GCA_014737335.1
- Location
- JACXIO010000290.1:62776-63331[-]
Transcription Factor Domain
- TF Family
- zf-LITAF-like
- Domain
- zf-LITAF-like domain
- PFAM
- PF10601
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family display a conserved zinc ribbon structure [3] with the motif C-XX-C- separated from the more C-terminal HX-C(P)X-C-X4-G-R motif by a variable region of usually 25-30 (hydrophobic) residues. Although it belongs to one of the zinc finger's fold groups (zinc ribbon), this particular domain was first identified in LPS-induced tumour necrosis alpha factor (LITAF) which is produced in mammalian cells after being challenged with lipopolysaccharide (LPS)[2]. The hydrophobic region probably inserts into the membrane rather than traversing it. Such an insertion brings together the N- and C-terminal C-XX-C motifs to form a compact Zn2+-binding structure [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 9.6e-27 7e-23 80.8 12.3 2 70 55 124 54 124 0.96
Sequence Information
- Coding Sequence
- ATGTATAATACTGGACCACCACCACCTTATGAATCACCTCCATATGCACCACCTGGTTATTCACAAACAGTGGGTGGTGTTCTACCTGCTAGCCCTTTCACATCTGCAGAAACTTACACAACTGGACCAAATATAGTAACAACAATTGTTGCACTAGGGCCAGGATCAACACATACAATTTGTTCACATTGCCATGCAGAAATAGATACTACAACAAAAACAGAACCTGGCATGATTGCCTATATATCTGGGGTTGTAATTGCATTAATGGGATGTTGGTTGGGATGCTGTTTGATTCCATGCTGTATTGATGAATGTATGGATATTCATCATAGTTGCCCTAACTGTAAAGCTTATCTGGGACGTTATAGGAGATAA
- Protein Sequence
- MYNTGPPPPYESPPYAPPGYSQTVGGVLPASPFTSAETYTTGPNIVTTIVALGPGSTHTICSHCHAEIDTTTKTEPGMIAYISGVVIALMGCWLGCCLIPCCIDECMDIHHSCPNCKAYLGRYRR
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00231681;
- 90% Identity
- iTF_01418694; iTF_01419338; iTF_00141518; iTF_00142766; iTF_01419983; iTF_01418065; iTF_01420625; iTF_00982645; iTF_01421240; iTF_00140953; iTF_00142169; iTF_00983324; iTF_00983904; iTF_00964163; iTF_00964804; iTF_01123364; iTF_01065925; iTF_00361288; iTF_01070028; iTF_00625837; iTF_00962189; iTF_01122766; iTF_00360592; iTF_01068657; iTF_01069330; iTF_01424724; iTF_01070741; iTF_00962874; iTF_01067290; iTF_00118366; iTF_00963551; iTF_01067967; iTF_01539980; iTF_01066627; iTF_00306646; iTF_00218791; iTF_00216072; iTF_00220938; iTF_00222218; iTF_00226959; iTF_00229039; iTF_00229711; iTF_00230994; iTF_00232306; iTF_00214707; iTF_00216756; iTF_00218100; iTF_00227637; iTF_00232918; iTF_00228343; iTF_00233591; iTF_00221625; iTF_00222873; iTF_00215386; iTF_00217435; iTF_00225595; iTF_00219484; iTF_00230396; iTF_00220160; iTF_00224922; iTF_00223557; iTF_00224241;
- 80% Identity
- -