Basic Information

Transcription Factor Domain

TF Family: zf-BED
Domain: zf-BED domain
PFAM: PF02892
TF Group: Zinc-Coordinating Group
Description: The BED finger, which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain [3].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 8 0.3 4.9e+02 1.5 2.1 17 29 38 50 29 58 0.78

2 8 0.074 1.2e+02 3.4 1.8 13 27 62 76 51 78 0.79

3 8 6.8e-06 0.011 16.3 5.6 2 41 80 115 79 117 0.93

4 8 0.11 1.8e+02 2.9 0.4 18 29 123 134 119 140 0.82

5 8 0.00091 1.5 9.5 1.6 6 41 140 171 135 173 0.82

6 8 0.0035 5.7 7.7 1.3 5 31 167 192 163 201 0.83

7 8 0.00022 0.37 11.5 3.8 4 38 194 224 191 228 0.81

8 8 0.0022 3.6 8.3 1.9 4 32 222 249 220 250 0.84

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	8	0.3	4.9e+02	1.5	2.1	17	29	38	50	29	58	0.78
2	8	0.074	1.2e+02	3.4	1.8	13	27	62	76	51	78	0.79
3	8	6.8e-06	0.011	16.3	5.6	2	41	80	115	79	117	0.93
4	8	0.11	1.8e+02	2.9	0.4	18	29	123	134	119	140	0.82
5	8	0.00091	1.5	9.5	1.6	6	41	140	171	135	173	0.82
6	8	0.0035	5.7	7.7	1.3	5	31	167	192	163	201	0.83
7	8	0.00022	0.37	11.5	3.8	4	38	194	224	191	228	0.81
8	8	0.0022	3.6	8.3	1.9	4	32	222	249	220	250	0.84

Coding Sequence: ATGCAGTCTGTCTATGACGGGGCGCTTAATCTATCAAAACCTTCAATAGGCCTACAGCTACATTCTAGAAACAacataagtaaaaaaattaaacatcttGGAGGCAAGTGTTTTAAATGTGATAATTGTGGcaaagaattttctttaaattcttcACTTCGAGCGCATTGCCGTATACATGTTGCGGAGAAACTGTTTAAATGTAATGTTTGTAGTAAAGAATTCACAAAAAATTGTAAGCTTAAAAATCACTTTCGTATCCATACTGGAGAAAAGCCTCATAAATGTCATGTTTGCAACAAGGAGTTTTCAGAAAGTGGCAATTTAAAATCTCACTTACGGACGCATTCCGGAAATAAACCGTATAAATGTGAAGTCTGTAACAAAGAGTTCTTTCGAAGTGAACATCTGAAAGTACATTATCGAATTCATTCAGGAGAAAAACCATTTCACTGTGATATATGTAGCAAAGAGTTTTCGAGAAGTGCTAGACTTCGAGAGCATTTTCGTACTCATACAGGAGAGAAACCTTATAAATGTGAGATTTGTCAAGCTACATTTTCAGACAGTGGAAATCTAAAAGTACATTATCGCATCCATACTGGCGAAAAACCTTTCAAGtgcaaaatatgtaataaaaatttctCTCAACACGTTGGGCTTAAAAGACATTATCGTACTCATATTGAAAATAAGCTATTTAAGTGTGATATGTGTAGCAAACATTTCTCCAGAAGTATTTCTAccaagtttaattaG
Protein Sequence: MQSVYDGALNLSKPSIGLQLHSRNNISKKIKHLGGKCFKCDNCGKEFSLNSSLRAHCRIHVAEKLFKCNVCSKEFTKNCKLKNHFRIHTGEKPHKCHVCNKEFSESGNLKSHLRTHSGNKPYKCEVCNKEFFRSEHLKVHYRIHSGEKPFHCDICSKEFSRSARLREHFRTHTGEKPYKCEICQATFSDSGNLKVHYRIHTGEKPFKCKICNKNFSQHVGLKRHYRTHIENKLFKCDMCSKHFSRSISTKFN

Sequence clustering based on sequence similarity using MMseqs2